Conserved Protein Domain Family
Peptidase_U57

?
pfam05582: Peptidase_U57 
YabG peptidase U57
YabG is a protease involved in the proteolysis and maturation of SpoIVA and YrbA proteins, conserved with the cortex and/or coat assembly by Bacillus subtilis.
Statistics
?
PSSM-Id: 310286
View PSSM: pfam05582
Aligned: 74 rows
Threshold Bit Score: 324.449
Threshold Setting Gi: 524259537
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123525276   1 MARKSYGKDIFFKVKAL-TiTDKGT-TTAILRGLDVRLVADAPLDDLELQPAEEVLRYRHDDIQRHNLCIRRI------L 72
gi 524598295  10 VGRISYGKDIIFVVEDI-M-KVNNK-EVAILKGVTIRIKADSPLDDLEILSKELVEENERKLEKRFQERIKRCsqlys-- 84
gi 524251742  10 VGRISYGKDILFVVDRI-I-KTNSRnEIAILKGLTIRIKADSNIEDLEVIEKRIVKEKIQLFENRIEDELKKC------L 81
gi 524608602   9 VGRKSYGKDIYFIVNQIlT-TTRNH-KFAILKGLNIRIEADSPIEDLEIIGKDEIISSIKKYDSFLEERIKKnriye--- 83
gi 524259537   9 VTRESYNNDTVFKIIEI-K-DS-----IAILQGVNIRLIADSNISDLVLCE-----KCKEDLETDDSKLLERMdsf---- 72
gi 504023087  10 VARKSYGQDIYFTVVDI-VnKNGAK-PVYVLRGLFYRIEADSSPEDLIKQDYKNVQMNIQRAILNVKRNIYRHgyanrlF 87
gi 489608706  10 VTRKSHGQDIYFIVTDI-QnKDSSK-PVYILRGLFYRIIVDAFEDDLVKKDSRSTRINLRRDLTMARSNAYRQiftsrcF 87
gi 524708057  10 VARKSYGKDIIFYIKKI-I-KNSNS-EVAILCGLFERIEADSSVDDLELLDHNFVKKMFSNEEKRLSSRIDTKnndyrf- 85
gi 524463337  10 VVRKSYGKDIIFRVINI-L-NKPEE-KIAVLNGVIERIEADSKIADLELVDKQKVKDILRKMDSKIENRIEKSkqqwedr 86
gi 524298901   9 VGRLSYNKDIVFTVSNI-I-KCRNQ-DIAILKGLVTRIEADSPLDDLELIDNNRVINLLDSFEKELEKSKKNLvnv---- 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123525276  73 QRRAVEKEalftrseeatareksadrqaTPENFFEVPGRVLHLDGDEEYLDKCLHAYEQLKLPAHGVYVPEEQQANKVKD 152
gi 524598295  85 ------------------------nsknNREREIIYTGKILHLDGDKKYSVKANNYYKKIGLNAIVKNIAESKQSSVVAD 140
gi 524251742  82 KYIEldkr-----------------------gkdvLAGKILHLDGDKKYSEKSLRCYRSLGLEAIVKNIKENEQVRFVKS 138
gi 524608602  84 ------------------------snekNFTRQKIYLGKILHLDGDRRYSDKSAKYYNKAGLNAIVKNVPENRQASIVVP 139
gi 524259537  73 -------------------------nklNRDEYFYLPGKVLHIDADKEYLDRCMNFYKKMNVLSYGIVMKEKDVSSNIYK 127
gi 504023087  88 WLNRLRQR----------------------------PGKILQLDSSEKFLNMCKNNYKEAGINVVGIVAEEREQPNLVVR 139
gi 489608706  88 LFSKPRQR----------------------------PGKVLHIDSSESFLKMCRNLYKEAGITSREYLAPESEQPNIIKR 139
gi 524708057  86 ----------------------nsfedsLNLRKKIITGKILHLDGDKRYSQKSYNYYKKMGLNAIVKNIPEYKQPHVVYK 143
gi 524463337  87 ny------------------rigvvtnqTRAKEKIITGEILHLDGDRKYSEKSYRYYRKLGLNAIVKYIPEYRQPRVVYQ 148
gi 524298901  82 -------------------------qnnMFKRYYQHYGRILHLDGDRKYSEKSQKVYKSMGLNVIVKNIPESKQPQMIWG 136
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123525276 153 LLQEYTPDILVLTGHDGL-LRERSNFSDLDSYRHSKHFLAAVKAARALRPGHD-DLVIFAGACQSHYEALLKAGATFASS 230
gi 524598295 141 LLIKYKPDILVITGHDGM-IKKGTKYNDIHNYRNSGYFVDCVKQARNYQDLKK-DLVIFAGACQSYYEGLILAGANFASS 218
gi 524251742 139 LLERYRPDILVITGHDGM-LRGETKYNDIYNYRNSRYFINSVMEARRWDNKGR-DLVIFAGACQSYYEAIIGAGANFASS 216
gi 524608602 140 LLKKYNPDILIVTGHDAM-LKKGTNYNNIYNYRNSRHFINTVKEARRWGSSSD-KLVIFAGACQSFYEAIIASGADFASS 217
gi 524259537 128 YLNEIKPDILVVTGHDAYnSKDYDDYKNNNNYKNSMNFINAVRNARKYEKDQE-KLIIIAGACQSNYEELIKSGANFASS 206
gi 504023087 140 ALKDYKPDILILTGHDGI-KKKSGNLKSIENYRNSKYFIQAVKLAREYESNFD-KLCIFAGACQSYFEAIMAAGANFASS 217
gi 489608706 140 ALAETKPDILVVTGHDSL-KKGS-DPNLLDSYRNSKYFIECVKEARKYQPDYD-KLCIFAGACQSYFEAIMQAGANFASS 216
gi 524708057 144 LLKIYQPDILIITGHDGM-IKKGSNYNDIYNYRNSRHFINTVKEARRYDKENQtDTVIFAGACQSYFEAIMMAGANFASS 222
gi 524463337 149 LLESYNPDILVITGHDGM-IKRGMRYNDIYNYRNSRYFIETVKEARKYDKQKGkKLVIFAGACQSYFEAIISAGANFASS 227
gi 524298901 137 LLGKYNPDILVVTGHDGM-IKKGYNFNDIYNYRNSKYFVETVIRARMWEQGAN-KLAIFAGACQSYYEAIMEAGANFASS 214
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 123525276 231 PLRVLIHAYDPVFVVERVAYTSIEKTLAPAEIIKDTITGNEGVGGVEIKGKLRLGYP 287
gi 524598295 219 PARILIDFIDPLIVAERVAITDEKKFLTINDIEGELRDGKRGISGIGANGKKKIMLm 275
gi 524251742 217 PGRILIDFMDPLIVAEKIATTDESKYVTISDIERNLRDGIKGVNGIGAMGKKKIvtk 273
gi 524608602 218 PGRILIDFVDPLIVAEKIAIADECRFVTSNEISREIKEGVKGVSGVGARGKKKIig- 273
gi 524259537 207 PKRINIHALDPAIVASSISLSDKGKPIDLIGILDKTKYGASGIGGIITNGTMYVGYP 263
gi 504023087 218 PGRININALDPAIVCEKVALTDENRYVSPQEVAKLTISGEKGIGGIRTKGHLKRL-- 272
gi 489608706 217 PGRININALDPAIVSEKVALTNKDNYVTPEEVSKLTISGSKGIGGIKTRGHLTVL-- 271
gi 524708057 223 PARILIDFLDPLIIAEKIATTERYKFITIDDVTNELRDGKKGVGGIGSNGRMVLV-- 277
gi 524463337 228 PARILIDFLDPLVVAEKIALTEKYKYITIDDIAYELRDGRDGIGGIGANGKMTKC-- 282
gi 524298901 215 PARILIDFKDPLVVAGKIATTDFNKYVTINDIKNDLRDGENGVSGIGAHGKKRTI-- 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap