Conserved Protein Domain Family
DUF763

?
pfam05559: DUF763 
Protein of unknown function (DUF763)
This family consists of several uncharacterized bacterial and archaeal proteins of unknown function.
Statistics
?
PSSM-Id: 310275
View PSSM: pfam05559
Aligned: 79 rows
Threshold Bit Score: 391.891
Threshold Setting Gi: 315425508
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121693406  12 GTADLPLHDGRAPPWLFSRMRLLAGEIARVIIYEYGEQELLRRISDPFWFQAFSCVLGFDWHSSGTTTTTTGALRA-S-- 88
gi 74560945    9 rAAELRL-VKCPPPRHFPEMVKLSRALFRLLVEEHGTDGALEKLADPRWFQSLACLLGYERNTSGSTTVVTAALRE-A-- 84
gi 74543609    7 GISALPLHYGHPPEYLFKRAVKLSGIMAEIIVDTYGQGELIRRLADPFWFHSLSLVTGFDWNSSGTTVFTLSALKE-Y-- 83
gi 74567918    5 GTSVMPLHYGHPPEYLYKRMVKLSGILSDIIIDNFGTRKLLENLSDPYWFHSFSLAIGFDWNSSGTTTATLGAMKE-Y-- 81
gi 500145633   5 GVADLPLHTGHVPAWLAAYMKKLARAIMEAVVEFYGPRRLVEYFADPVWFQAFNNAIGMDWDSSGSTTVTIGIVRQ-V-- 81
gi 503793431   7 GVAELPLHDGHVPRWMAERMKRLLRAIVAFIVEDRGPGWLVERLADPLWFQALNNVIGMDWDSSGSTTVLTGLLRQ-V-- 83
gi 530558374   8 GTAYLPLHYGKPPELLYRKIVRLTGQICELISETYGTKELIWRMADPVWFHSLSLVTGFDWNSSGTTTTTLHALKE-Y-- 84
gi 530559445   5 GSAILPLHYGHPPEYLYRRMVKLGGLISDLIIERFGVEEYLEKVSDPFWFHSLSLAIGFDWNSSGTTTATLSAIKEhY-- 82
gi 850980885   4 GFAELPLHDGHVPLFLLERMKKLGGLIARYIVEYYGPRELLTRLSDPLWFQAFNNVIGMDWDSSGSTTIVLYVLKN-Mfp 82
gi 315425508   5 GTATLWLTEGPVPH--FREMVELGREIMRALCAQVGYEETVRRFADPFWLSSLACALGFEWDTSGQTTVTLKALSL-G-- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121693406  89 -L-R-PEDGVVVAGGKGATSLKTPVEIMRYGEIFSLS--E---RKiedL---IRASRLSAKVDNALVQDGYRLYHHAFIL 157
gi 74560945   85 -LdP-EEHGIAVAGGKGRLALETPKRVRELADRMNLD--P---RQ---L---VTASRLTARSDSVCLQDGHDLYHHVIVF 151
gi 74543609   84 -LsT-RDLGVKVCGGKASAMADMRADLLSSVETGILK--E---DDkeyV---YENARRIAKIDNSLLQDGYDLYMQFVVV 153
gi 74567918   82 -L-N-KKDDIIILGGKGRHIRNIKNEFDEIERSGNVD--N---KDlyrV---MKGSRLSGITDNKLLQDSFDLYIQFIIM 150
gi 500145633  82 -VeEtPHLGIGVAGGKGRRARETPKDLEIIGERLGLP--SrivEE---L---KYVSRLAAKTDSAVLQDGYTLYHHSVIV 152
gi 503793431  84 -TeT-GEFGLMVAGGKGRRALETPSDLEVIGEKLGLS--S---SRveyL---KRVSRLAAAADSSLLQDGFQLYHHTVIV 153
gi 530558374  85 -SnS-KDLDFFVAGGKGIHMKEKSEDISTRSQLFATEkiP---ER---V---RKETDLAAKIDENLLQDTYDLYIHSVVL 153
gi 530559445  83 -SrL-KDSPVFILGGKGRHLGEMAAESMEIVATGALS--E---SK---IhriMEDARRIARVDQNLLIDGFDLYMQFLVL 152
gi 850980885  83 pSmF-RDNEIAVLGGKGRDSRNVVEEAWLVGDV--VD--Y---NT---V---VDTSRMAAKIDGVALQDGYSLYIHGLVI 148
gi 315425508  80 -LmG-TDIPVRVLGGKGAEMRMAQLEAGKLLAEIGVR--Ev--GE---I---RRAMRLTTSVDNAALQDSYDIYFQAAAV 147
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121693406 158 TSNGEWAVVQQGMNE--RYARRYH-WLSDKLYSMIE--EPHAAICAQRLESrVMDLTSKESRENRQATLDLVR------- 225
gi 74560945  152 DENGRWVVIQQGMDVdrKTARRYH-WLDSEVSEFV---EGHPVVADETRK--VLSLQGDRADKCREAVLDLVG------- 218
gi 74543609  154 SDRGRHAVIQQGMNSedRMARRYH-WL-IGNERVDV--EGRYGLSADKTSLnVLDLSATESRDNRSAIVASVR------- 222
gi 74567918  151 DYHGNYTVINQGMNTdlGLARRYH-WI--NPNDFYN--GSRSGISG-YENKnVLDLSSIESEKNRMDMIDVIH------- 217
gi 500145633 153 SEDGAWVVIQQGMNVeaKMARRYH-WRSPLPRTPTL--EPHSAIASQRREDfVVDLTSRKSLEARRLIVDLAS------- 222
gi 503793431 154 AEDGSWTIVQQGMSLeeRVARRYH-VSHRVVHEGVEtlEPHTGVVSRLRRSaVLDLTSRASLEARRVIVDVAR------- 225
gi 530558374 154 DYKGNYSVIQQGLNYeeKMARRYH-WSSKHIMEKME--ESRMGIRTDLLSDnCLDLSSPLSRKSRDSMLKAIK------- 223
gi 530559445 153 DTHGKWSIVQQGMNPqqRMARRYH-WISRTGLDFFN--DGRNGISAPRQMDrVVDLTTRNSEGNRRSMLEMARedplryr 229
gi 850980885 149 DSRGGILVIQQGLNEelGIARRYHiFTSSHPLTTNR--DPHSGVAS-VKMEpSLNLVDADSLNARRAIVEIIA------- 218
gi 315425508 148 SESGQWAIINQGMNTvnKTARRYH-W-SSDRGLGVE--EPHTEILSDTVEDvVLDLTSTTSAETRQTILEVLE------- 216
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121693406 226 ----DGP-----------------SHI---KK---------------------------------------Y-------- 234
gi 74560945  219 ----DGP-----------------DRV---LR---------------------------------------Ewravrnsi 235
gi 74543609  223 ----EGEvwrf---------rsgaQST---LD---------------------------------------Nfslp--fl 245
gi 74567918  218 ----DMPky-------------dkQRT---LD---------------------------------------Nfnar-lel 237
gi 500145633 223 ----ENP-----------------SRLassIR---------------------------------------Eayalakgi 242
gi 503793431 226 ----EKP-----------------ERV---LR---------------------------------------Llreaiava 242
gi 530558374 224 ----EKPkis-----------nenQRT---LD---------------------------------------Yysdekvl- 245
gi 530559445 230 mkltEGP-----------------QKT---LDnfqnqqdv------------------------lrldyriN-------- 257
gi 850980885 219 ----STPvnsllq------nigevNRL---LRgehsilswsnsgsitrktgnrnlikecpryyrpvsnirlM-------- 277
gi 315425508 217 ----DTPpsrlnedlaqvkaiarkQHT---LTstfeelptip--------------------khlsppnrlD-------- 261
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121693406 235 -TAQRSledfspalRMPARHEILPVDIGRDG---LRILQAAYELQPSTYEELVMLRGMGPKRVRALTLIAELIFGAPPSW 310
gi 74560945  236 sGPLDE--------YLGREGGVEVPDGWVPRrldRDALRRLYEVNPTDFKEFLTVRGVGPSLVRALALIAEVVYGEGPDR 307
gi 74543609  246 dLSGRVn---------------------------WKKLRDLYEYGVDDFEKIYMEKGIGKSTLRALSYIAEVIYGPKASF 298
gi 74567918  238 dLNYKIe---------------------------WKKLKKIYDYNPENFDDFIKIKGLGKSTIRAISYLAEIIYGDKPSY 290
gi 500145633 243 vpltmwsnvrdearrvieqyrryyrpqlkppkniEAVLRRVWELSPRSFEELVMIEGVGPATLRSLALVAEIIYGVPISH 322
gi 503793431 243 rgvvpltsfsggkrpsqtviryyrplkppdprriEPVLRRVYELQPDTIEALVSIRGVGPATIRALALIAELVYGSEASH 322
gi 530558374 246 ---------------------------nlaikvpWKNLEKIYEFEPSNFDDLLFIPGAGKSTIRALCYIAEVITGERPSY 298
gi 530559445 258 ----------------------------------WAKMREIYEYQPSSFQDIAFMKGMGKSTIRALSYLAEIIYGEKPSF 303
gi 850980885 278 ----------------------------------EKIAEEIKERGLREFDELLRIQGVGAETIRALALVADLIYGYRPSL 323
gi 315425508 262 ----------------------------------EETIRRA--KNVSSFDELLTTQGVGAATLRGLAYIAALVYGSKVSW 305
                        410       420
                 ....*....|....*....|....*..
gi 121693406 311 RDPA-------RYSFAHGGKDGYPYPV 330
gi 74560945  308 RDPA-------EYTAAFGCKSGDPYPV 327
gi 74543609  299 RDPV-------KFSFAVGGKDGIPKPV 318
gi 74567918  291 KDPV-------KFSFCLGGKDGVPKPV 310
gi 500145633 323 HDPAsspidpfRYAYIAGGKDGVPFPF 349
gi 503793431 323 EDPAvtd--plRYAFAVGGKDGYPYPF 347
gi 530558374 299 EDPV-------RYSYALGGKDGIPKPV 318
gi 530559445 304 RDPV-------KFSFAVGGKDGVPKPV 323
gi 850980885 324 RDPTtsimdpfIYAYAHGGKDGVPYPI 350
gi 315425508 306 RDPV-------KFSYAFGTKSGKPYPV 325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap