Conserved Protein Domain Family
Allexi_40kDa

?
pfam05549: Allexi_40kDa 
Allexivirus 40kDa protein
Statistics
?
Aligned: 7 rows
Threshold Bit Score: 374.499
Threshold Setting Gi: 81922148
Created: 20-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q88457 109 ERTFFSNLDTALNSTQALLNHVPPARYTLPPASLPVNELFGQLHALHLNTLEWLTHINHNLDSMLNMLNPVNLMS----- 183 Shallot virus X
Q8QXW2  94 QRTFFSNAGVAIDATRALLGYLPPTRYDVPPATLPLDELYGQLHALHQNSLEWLTHINHNVESIIDFFNPNSLFS----- 168 Garlic virus E
O55605  94 QRTFFSNANIALDATRTLLGYVPPARYDVPPVTLPLDELFGQLHALHQNSLEWLTHINHNVDSILDMLNPSNLLS----- 168 Garlic virus D
Q67692  94 FRTFFSNAALAVDATRTLLGYVPPARYNIPPSTLPLDELYGQLHALHQNTLEWLTHISHNVDSILTNLNPINSPS----- 168 Garlic virus A
O55604 101 NRVLFSNAALALEATRNLLSHVPPTRYNLPQTTLPLDELYGQLHALHQNSLEWLTHIGSDTDRLIVDFGTFSSTAvanhd 180 Garlic virus C
Q67696  93 DRTFFTNLNAALTATGNLLTHVPPARYNLPATSLPLDELYGLLHALHKNSLEWLTHLSHDADQIINKLNTV--------- 163 Garlic virus B
O09501  24 NRTFFTNLSTALDTTSNLINHVPPTRYTLPSVALPLDELYGLLHALHRNSLEWLTHISHDTEQVINKLNNI--------- 94  Garlic virus X
Q88457 184 -QGTPLSRLRDAVRTLTQDLGSIKSDQQKILASISTIDHSDILHKLDSLDTGLRQLGIRLDVVVSSLNHMNER-PPNASH 261 Shallot virus X
Q8QXW2 169 -QGTPLSRLRDAITTLTRTVDDIHSVLTYTELSPEHASSSKAQTKFEVIERSLEALHQKVDKLALLAESNPAP-PQVSPN 246 Garlic virus E
O55605 169 -QGTPLNRLREMLVALTGKVDDIYATIQSSRLETNQPSSSKPVNRFETIEHSLESLHIKLDELTSAVAHALDH-PHVTPV 246 Garlic virus D
Q67692 169 -QNNSLSQIHAALTYLTRTVDSLYSNSQSTSISTDQPSSSKPL-------TSLEALHRKIDELSSSLTNTTPG-PSVTPN 239 Garlic virus A
O55604 181 rMTTHLANIRDELHTLRDLPQLLNRLLKQQELHLQTLTDTQ--KEITALKT---LIHHNL---TQSQTQESST-PSSSQS 251 Garlic virus C
Q67696 164 -ENGVLNEARSDSRRLDLILQRISEVESKINDQATPTLDHHLLKTLTSIETRLQELHAKL---IATPTDNPAG-PSSSMT 238 Garlic virus B
O09501  95 -ETILLSEVRTNSRKIDTVFEKLANIESHLINSEKSDFERELAKSLASIETQIQDVHARFREMSHHESSTLGGnPGTSPT 173 Garlic virus X
Q88457 262 DIASSSAATDRNpLPLYQAVHPSLFCRTYGNILYNGVDSRIPMDITGRPASTSLKLTITVDCSEQSTKVNFTLLDDGYIL 341 Shallot virus X
Q8QXW2 247 SAKTPPLGAPED-LPVYQAVHPTTSCRTYGTIIFDGTSSRIPMDILGRPASTALRLDMTVATSSQNTTVSYKMFDDGYLL 325 Garlic virus E
O55605 247 PDEMRPSASTRD-LPAYQAQHPTRPCRAYGTVLFEDKILRIPMDITGRPVSTALKLELHLTTNDQTTMVSYRIYDDGYLL 325 Garlic virus D
Q67692 240 PSAPLPTNAARN-LPIYQAAHPSKPCRTYGTILLDGVHSKIPMDIIGRPASTALRLELRVTPSDQSTTVSYKIFDDGYLL 318 Garlic virus A
O55604 252 GATTHQPQPSD--LHPYQARHPTTRCRTYGTLIYNGSSLHMPMDILGKPASTALQLQVALNLRGRDQR-DLQISDNGALL 328 Garlic virus C
Q67696 239 KPSGADTHSDHSvLPIFEAKHPTARCRSYGHVEFNGLSLHIPMDVQGRRPSTALRLITKHTLSSDATTVKYELLDDGALL 318 Garlic virus B
O09501 174 PESS----VINSlLPTFNPEHPTARCRAYGSVEFGGTVLQIPMDVRGRRASTALRLSVMYTPKREATTVKYKLFDDGALL 249 Garlic virus X
Q88457 342 LSDSIETKHKLQHIPSDCLSLIHARCPKFVYKFRGEGLC 380 Shallot virus X
Q8QXW2 326 LSENVETAHKLQHCPNDCLALLHQRCQNFIYKIRSHGLC 364 Garlic virus E
O55605 326 LSDDVETAHKLQHRLSDCLALLHQRCPNFIYKIKGHGLC 364 Garlic virus D
Q67692 319 TSDDIETNHRLQHYPSDCLALLHQKCPNFIYKIKTHDLC 357 Garlic virus A
O55604 329 LSDEIFTPHKLNKPLSDALSLLHDNCSNFIYNNKGGRLC 367 Garlic virus C
Q67696 319 LTEEIKPLYKLNHPLSDSLALLHSKCPNFIYKIRDDGLC 357 Garlic virus B
O09501 250 FTEELSTQHRFTQPFGDSLALLHSKCPNFLYKIRDEVLC 288 Garlic virus X
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap