6BLB


Conserved Protein Domain Family
RuvB_N

?
pfam05496: RuvB_N 
Holliday junction DNA helicase ruvB N-terminus
The RuvB protein makes up part of the RuvABC revolvasome which catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalyzed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.
Statistics
?
PSSM-Id: 398900
View PSSM: pfam05496
Aligned: 92 rows
Threshold Bit Score: 272.451
Threshold Setting Gi: 44888417
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6BLB_A  27 IRPLKLADYIGQPSVREQMELFIHAARGRQEALDHTLIFGPPGLGKTTLANIIAQEMGVSIKSTSGPVLERPGDLAALLT 106
Q1AWE0  42 LRPRTLDEFVGQERLKENLRIFVEAAKQRGEPLDHMLLAGPPGLGKTSLCRILAAEMGVQLHPTSGPSLERAGDMAAILT 121 Rubrobacter xylanophi...
A5GQ68  36 LRPRRLADYIGQSELKQVLGIAVEATRLRNDALDHVLLYGPPGLGKTTMALVLAEELGVSCRIASAPALERPRDIVGLLM 115 Synechococcus sp. RCC307
Q46IJ6  40 LRPKSFDDFVGQSELKKVLEISVKASLKRGEALDHLMLYGPPGLGKTTMALVIAEELGVKARVTSAPALERPRDIVGLLI 119 Prochlorococcus marin...
Q7V9Q4  40 LRPKCWDEFIGQSALKEVLGISVKAALSRKEALDHVLLYGPPGLGKTTMALVLGNELGVKCRITSAPALERPRDIIGLLL 119 Prochlorococcus marin...
B1WP72  35 IRPHSFDEYIGQKDLKDVLSIVIEAAKTRNEPMDHLLLYGPPGLGKTTISLILASAMGVNCKITAAPALERPRDITGLLV 114 Crocosphaera subtropi...
Q8YT32  49 IRPQRFADYIGQKDLKDVLDIAIKAAKSRGEVLDHLLLYGPPGLGKTTMAMILASEMGVNYKITSAPALERPRDIVGLLV 128 Nostoc sp. PCC 7120 =...
Q7NGP9  47 LRPKNLVDYAGQKDLKAVLGIAVAAAKSRGESLDHLLFYGPPGLGKTSISLILAREMNVQIHLTTAPALERPRDIAGLLV 126 Gloeobacter violaceus...
Q02AG6  22 LRPRRLADFTGQSKLKENLSIAIEAARMRGEAMDHVLLYGPPGLGKTTLASIIAEELQVQFTPTSGPVLQKKLDLTGILS 101 Candidatus Solibacter...
Q1IHV6  43 LRPQWLREFIGQPKVKENLAVAIEAARSRGEALDHVLLYGPPGLGKTTLANIIANEMQAQFQQTSGPTLQIKGDLTAILT 122 Candidatus Koribacter...
6BLB_A 107 NLEAGDVLFVDEIHRLSPIVEEVLYPAMEDFQLDIMIGEGPAARSIKLDLPPFTLVGATTRAGMLTNPLRDRFGIVQRL 185
Q1AWE0 122 SLEEGDFLFIDEIHRLNRQIEEVLYPAMEDFAIDIVLGQGPSARTIRMDLPRFTLVGATTRTGLMTKPLLDRFGFSARL 200 Rubrobacter xylanophil...
A5GQ68 116 NLQPRELLFIDEIHRLNRVAEELLYPAMEDFRLDLTVGAGPAARTRSLELPPFTLVGATTKAGSLSSPLRDRFGLIQRL 194 Synechococcus sp. RCC307
Q46IJ6 120 NIQPRELIFVDEIHRLNRISQELLYPAMEDRRLDLTVGKGTSSRMRSIEIPPFTLVGATTKPAALSSPMRDRFGITQRL 198 Prochlorococcus marinu...
Q7V9Q4 120 NLEPNELLFVDEIHRLSKVAEELLYPALEDFRIDLTVGKGTTARTREINLPRFTLVGATTKPASISSPLRDRFGITQRL 198 Prochlorococcus marinu...
B1WP72 115 SLKPGDILFIDEIHRLNRLTEELLYPAMEDYRLEITIGKGQAARTRSIPLPKFTLVGATTKVGSLTSPLRDRFGLIQRL 193 Crocosphaera subtropic...
Q8YT32 129 NLKPGDILFIDEIHRLSRMTEEILYPAMEDYRLDITVGKGSSARIRSIPLSKFTLVGATTRVGALTSPLRDRFGLIQKL 207 Nostoc sp. PCC 7120 = ...
Q7NGP9 127 KLRRGDILFIDEIHRLPRLTEEILYPAMEDYRLDITIGKGQNARITSVPLPRFTLIGATTRVGALSSPLRDRFGLIQRL 205 Gloeobacter violaceus ...
Q02AG6 102 NIRLHQVFFIDEIHRLLPDVEEMLYSALEDFRVDILVGVGPGARTHSLPMPKFTAIGATTRQGLVSAPLRGRFGLVLRL 180 Candidatus Solibacter ...
Q1IHV6 123 NVRDKQVLFIDEVHRLQPALEELLYSAVEDYKLDIIIGQGPSARTHTIDVAPFTLVAATTRAGLLSAPLRSRFGIVLRL 201 Candidatus Koribacter ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap