Conserved Protein Domain Family
RuvB_N

?
pfam05496: RuvB_N 
Holliday junction DNA helicase ruvB N-terminus
The RuvB protein makes up part of the RuvABC revolvasome which catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalyzed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.
Statistics
?
PSSM-Id: 310239
View PSSM: pfam05496
Aligned: 91 rows
Threshold Bit Score: 380.68
Threshold Setting Gi: 44888417
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7MWU9   8 RQERYrgndgE--REVENKLRPLTFDSFSGQDKVVENLSIFVAAARLRGEALDHTLLHGPPGLGKTTLSNIIANELGVGL 85  Porphyromonas gingiva...
Q5YTE8  12 SFLKS-----D--GEIEASLRPKSLDDFIGQPRVREQLALVLRGAKQRGSTPDHVLLSGPPGLGKTSMAMIIAAELGTAL 84  Nocardia farcinica IF...
Q02AG6  10 DRQAE-----D--AQFEVGLRPRRLADFTGQSKLKENLSIAIEAARMRGEAMDHVLLYGPPGLGKTTLASIIAEELQVQF 82  Candidatus Solibacter...
Q1IHV6  31 IPVED-----D--SSFELKLRPQWLREFIGQPKVKENLAVAIEAARSRGEALDHVLLYGPPGLGKTTLANIIANEMQAQF 103 Candidatus Koribacter...
A5GQ68  22 EATAA-----EgdGGRDEGLRPRRLADYIGQSELKQVLGIAVEATRLRNDALDHVLLYGPPGLGKTTMALVLAEELGVSC 96  Synechococcus sp. RCC307
Q46IJ6  26 SLLKE-----ElkLSQQDSLRPKSFDDFVGQSELKKVLEISVKASLKRGEALDHLMLYGPPGLGKTTMALVIAEELGVKA 100 Prochlorococcus marin...
Q7V9Q4  26 TPSLE-----EgkVRKEDSLRPKCWDEFIGQSALKEVLGISVKAALSRKEALDHVLLYGPPGLGKTTMALVLGNELGVKC 100 Prochlorococcus marin...
B1WP72  23 ETHQE-----Q--DNLEESIRPHSFDEYIGQKDLKDVLSIVIEAAKTRNEPMDHLLLYGPPGLGKTTISLILASAMGVNC 95  Cyanothece sp. ATCC 5...
Q8YT32  36 EAAID-----Eq-GKQEESIRPQRFADYIGQKDLKDVLDIAIKAAKSRGEVLDHLLLYGPPGLGKTTMAMILASEMGVNY 109 Nostoc sp. PCC 7120
Q7NGP9  36 ERAHE--------DQHEESLRPKNLVDYAGQKDLKAVLGIAVAAAKSRGESLDHLLFYGPPGLGKTSISLILAREMNVQI 107 Gloeobacter violaceus...
Q7MWU9  86 KITSGPVLDKPGDLAGLLSSLESNDVLFIDEIHRLSPVVEEYLYSAMEDYRIDIMLDKGPSARSIQINLSPFTLVGATTR 165 Porphyromonas gingiva...
Q5YTE8  85 RITSGPALERAGDLAAMLSNLVEGDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVVGKGPGATSIPLDIAPFTLVGATTR 164 Nocardia farcinica IF...
Q02AG6  83 TPTSGPVLQKKLDLTGILSNIRLHQVFFIDEIHRLLPDVEEMLYSALEDFRVDILVGVGPGARTHSLPMPKFTAIGATTR 162 Candidatus Solibacter...
Q1IHV6 104 QQTSGPTLQIKGDLTAILTNVRDKQVLFIDEVHRLQPALEELLYSAVEDYKLDIIIGQGPSARTHTIDVAPFTLVAATTR 183 Candidatus Koribacter...
A5GQ68  97 RIASAPALERPRDIVGLLMNLQPRELLFIDEIHRLNRVAEELLYPAMEDFRLDLTVGAGPAARTRSLELPPFTLVGATTK 176 Synechococcus sp. RCC307
Q46IJ6 101 RVTSAPALERPRDIVGLLINIQPRELIFVDEIHRLNRISQELLYPAMEDRRLDLTVGKGTSSRMRSIEIPPFTLVGATTK 180 Prochlorococcus marin...
Q7V9Q4 101 RITSAPALERPRDIIGLLLNLEPNELLFVDEIHRLSKVAEELLYPALEDFRIDLTVGKGTTARTREINLPRFTLVGATTK 180 Prochlorococcus marin...
B1WP72  96 KITAAPALERPRDITGLLVSLKPGDILFIDEIHRLNRLTEELLYPAMEDYRLEITIGKGQAARTRSIPLPKFTLVGATTK 175 Cyanothece sp. ATCC 5...
Q8YT32 110 KITSAPALERPRDIVGLLVNLKPGDILFIDEIHRLSRMTEEILYPAMEDYRLDITVGKGSSARIRSIPLSKFTLVGATTR 189 Nostoc sp. PCC 7120
Q7NGP9 108 HLTTAPALERPRDIAGLLVKLRRGDILFIDEIHRLPRLTEEILYPAMEDYRLDITIGKGQNARITSVPLPRFTLIGATTR 187 Gloeobacter violaceus...
Q7MWU9 166 SGLLTAPLRARFGINLHLEYYDVHTITGIVERSARILEVSCSHDAAVEIAGRSRGTPRIANALLRRVRDFAQVKG 240 Porphyromonas gingivalis W83
Q5YTE8 165 SGALTGPLRDRFGFTGHMDFYEPGELLRILERSAQILGVRIETDAAAEIAGRSRGTPRIANRLLRRVRDYAEVRA 239 Nocardia farcinica IFM 10152
Q02AG6 163 QGLVSAPLRGRFGLVLRLDPYNTEELKAIVKRSARLLTVEIEDGAAEEIARRCRGTPRIANRLLRRVRDYAQVRA 237 Candidatus Solibacter usit...
Q1IHV6 184 AGLLSAPLRSRFGIVLRLEFYTTEDLKIILKRSAEILNVEIDEGGAAEIATRCRGTPRIANRLLRRVRDYAQVRG 258 Candidatus Koribacter vers...
A5GQ68 177 AGSLSSPLRDRFGLIQRLEFYSCSDLEAIVSRSAQLLQLELAAEAAAEIARRCRGTPRIANRLLRRVRDFASVRG 251 Synechococcus sp. RCC307
Q46IJ6 181 PAALSSPMRDRFGITQRLDFYNYLDLENIIKRSAKLINLVISEEASQQLAKRCRGTPRIANRLIRRVRDYAEVYS 255 Prochlorococcus marinus st...
Q7V9Q4 181 PASISSPLRDRFGITQRLNFYSISDLNRIIQRAADLFGLSLTGDAGLEIARRCRGTPRIANRLLRRVRDYATVQN 255 Prochlorococcus marinus su...
B1WP72 176 VGSLTSPLRDRFGLIQRLKFYEPEELALIIKRTAKLLNTSITEQGAAEIGRRSRGTPRIANRLLRRVRDYIQVKK 250 Cyanothece sp. ATCC 51142
Q8YT32 190 VGALTSPLRDRFGLIQKLRFYEVDELSQIVLRSAQLLQTQVTDDGATEIARRSRGTPRIANRLLKRVRDYAQVKS 264 Nostoc sp. PCC 7120
Q7NGP9 188 VGALSSPLRDRFGLIQRLRFYDVEELAGIIVRNAALLNISIDEPGAAEIARRARGTPRIANRLLKRVRDYAQVEG 262 Gloeobacter violaceus PCC ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap