4UER


Conserved Protein Domain Family
eIF-3c_N

?
pfam05470: eIF-3c_N 
Click on image for an interactive view with Cn3D
Eukaryotic translation initiation factor 3 subunit 8 N-terminus
The largest of the mammalian translation initiation factors, eIF3, consists of at least eight subunits ranging in mass from 35 to 170 kDa. eIF3 binds to the 40 S ribosome in an early step of translation initiation and promotes the binding of methionyl-tRNAi and mRNA.
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 727.325
Threshold Setting Gi: 6685524
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4UER_c     92 KSSNYDSSDEesDEEDGKKVVKSAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAQq-----QNWGTPNI 166 Saccharomyces cere...
O49160     34 RYLQSGSEDD--DDTDTKRVVKPAKDKRFEEMTYTVDQMKNAMKINDWVSLQENFDKVNKQLEKVMri---tEAVKPPTL 108 thale cress
NP_188926  32 rYLADLPDGEicCGMDTKRVVKPKKDKRFEEMANTIENMKHAMNINDCVYLQETFEKLNKQISK---------SVKTPTL 102 thale cress
O02328     31 AKFRDDLDFMagPEEDEKRVVRAQKDKKFDELKGIIKQNRDAKSNKDLNRLLTGFDSLAKAYDKSKtvf-qrQNVANPRF 109 Caenorhabditis ele...
A1ZAX1     24 NFNKASAFQFsdDEEEVKRVVRSTKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYQKALpviskeENGITPRF 103 fruit fly
O14164    152 KFLRGESSEEssDEEEGRRVVKSAKDKRYEEFISCMETIKNAMSSNNWIVVSNEFDHLNKVSQKc------kEAGRNPPP 225 Schizosaccharomyce...
P32497     92 KSSNYDSSDEesDEEDGKKVVKSAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAq-----qQNWGTPNI 166 Saccharomyces cere...
Q99613     29 GNYGKQPLLLseDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKsi---vDKEGVPRF 105 human
4UER_c    167 FIKVVAQVEDAVN----NTQQADLKNKAVARAYNTTKQRVKKVSR--ENEDSMAKFRNDPESFDKEPTADLDISANGFTI 240 Saccharomyces cere...
O49160    109 YIKTLVMLEDFLNealaNKEAKKKMSTSNSKALNSMKQKLKKNNK--LYEDDINKYREAPEVEEEKQPEDDDDDDDDDDE 186 thale cress
NP_188926 103 YIKTLVMLEDFLNe--dNMKTKEKMSTSNSKALNAMRQKLKKNNL--QYQEDIKRFRESPEIEDDDEYEEEVVEDSADNV 178 thale cress
O02328    110 YIRSLVEIEDYVNklwdDKDAKSALSKNNAKALPPLRQKLKKYIKdqQLQDLVTDYRVNPDEDGYETPEDEDDDDFGEVS 189 Caenorhabditis ele...
A1ZAX1    104 YIRCLAELEDFINevweDREGRKNLSKNNSKSLGTLRQKVRKYIK--DFEDDLSRFREAPDQESEAEDEVVALESDGGDA 181 fruit fly
O14164    226 YIEFLSALDQKLEs--aDKAFIKSLDAANGRAFNALKQRVRKNNR--QFQSDIDRYRKDPEGFMKPAELNEIPKPAGKAG 301 Schizosaccharomyce...
P32497    167 FIKVVAQVEDAVNn----TQQADLKNKAVARAYNTTKQRVKKVSR--ENEDSMAKFRNDPESFDKEPTADLDISANGFTI 240 Saccharomyces cere...
Q99613    106 YIRILADLEDYLNelweDKEGKKKMNKNNAKALSTLRQKIRKYNR--DFESHITSYKQNPEQSADEDAEKNEEDSEGSSD 183 human
4UER_c    241 Ss------------------------------------------------------------------------------ 242 Saccharomyces cere...
O49160    187 Veddddssidgptvdpgsdvdep--------------------------------------------------------- 209 thale cress
NP_188926 179 Swem---------------------------------------------------------------------------- 182 thale cress
O02328    190 Eskaekspgkpsekaavsdsdsdsddddssnwssepesnssddedsvtkmeq---------------------------- 241 Caenorhabditis ele...
A1ZAX1    182 Gddsdagvkpteavpkavksapakaapaddddsddsidwdsdsesetessddenqyqn-------------------mre 242 fruit fly
O14164    302 Qdevivdgvat--------------------------------------------------------------------- 312 Schizosaccharomyce...
P32497    241 Ss------------------------------------------------------------------------------ 242 Saccharomyces cere...
Q99613    184 Edededgvsaatflkkkseapsgesrkflkkmddededsedseddedwdtgstssdsdseeeegkqtalasrflkkaptt 263 human
4UER_c    243 ------------------------------------------------------SQGNDQAVQEDFFTRLQTIIDSRGKK 268 Saccharomyces cere...
O49160    210 ---------------------------------tdnltwekmlskkdklleklmNKDPKEITWDWVNKKFKEIVAARGKK 256 thale cress
NP_188926 183 ----------------------------------------------------lfSLDHEEITWNMVNKKFKEIRAARWSK 210 thale cress
O02328    242 ---lrryflkkefrveskddkkekkkrvirvkeaveedddadwtpvnreksvvhFDPKEEVTHDVMIKKLNEVMSARGKR 318 Caenorhabditis ele...
A1ZAX1    243 rflkrttekeekdddkrkdkrkeqktkirkraeddedgewetvvkghvvekpkmFEKDAEIDVPLVLAKLLEIMSARGKK 322 fruit fly
O14164    313 ---------------------------------------------rgivaptegLGKPEEITPADIFKYLRAIFEARGKK 347 Schizosaccharomyce...
P32497    243 ------------------------------------------------------SQGNDQAVQEDFFTRLQTIIDSRGKK 268 Saccharomyces cere...
Q99613    264 dedkkaaekkredkakkkhdrkskrldeeeedneggewervrggvplvkekpkmFAKGTEITHAVVIKKLNEILQARGKK 343 human
4UER_c    269 TVNQQ-------SLISTLEELLTVAEKPYE----FIMAYLTLIPSRFDASA-NLS-YQPIDQWKSSFNDISKLLSILDQT 335 Saccharomyces cere...
O49160    257 GTARF-------ELVDQLTHLTKIAKTPAQ----KLEILFSVISAQFDVNP-GLSgHMPINVWKKCVLNMLTILDILVKY 324 thale cress
NP_188926 211 RRSSSlklkpgeTHAQKHMDLTKIAKTPAQ----KVEILFSVISAEFNVNSgGLSgYMPIDVWKKCVVNMLTILDILVKY 286 thale cress
O02328    319 TTDRN-------QHVANLRKLLEVSEEKELglgiNVKISFCIISALFELNA-KISdHMEYETFMTTLQTVNSLLDLLIGT 390 Caenorhabditis ele...
A1ZAX1    323 RTDRR-------LQIDLLFELRDISDQHNLgtavSVKIHFNIISAIYDYNQ-KISePMKLEHWALLLEVMQSMMKLLLAN 394 fruit fly
O14164    348 STDRS-------EQIRLLEKLSTIAVTDYQ----RLRVKVALLAVRFDINT-GSGqYMPIDQWNAALTELHSILDIFDAN 415 Schizosaccharomyce...
P32497    269 TVNQQ-------SLISTLEELLTVAEKPYE----FIMAYLTLIPSRFDASA--NLsYQPIDQWKSSFNDISKLLSILDQT 335 Saccharomyces cere...
Q99613    344 GTDRA-------AQIELLQLLVQIAAENNLgegvIVKIKFNIIASLYDYNP-NLAtYMKPEMWGKCLDCINELMDILFAN 415 human
4UER_c    336 IDTYQvnefADPIDFIEdep--keDSDGVKRILGSIFSFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQL 413 Saccharomyces cere...
O49160    325 SNIVV----DDTVEPDEnetskptDYDGKIRVWGNLVAFLERVDTEFFKSLQCIDPHTREYVERLRDEPMFLALAQNIQD 400 thale cress
NP_188926 287 YNIVV----DDTVEPDEketskpaAYDGTIRVSGNLVAFLEKIETEFFKSLQCIDPHTNDYVERLKDEPMFLALAQSIQD 362 thale cress
O02328    391 DRVKLsvtyAEEDENLKddt-------qeYRIQGSILIAVQRLDGELAKILQNADCHSNDYIEKLKAEKDMCSLIEKAEK 463 Caenorhabditis ele...
A1ZAX1    395 ADIIMsesvAEEHEE---------YATSPFYVRGCPLAAVERLDDEFVKLLKECDPHSNDYVSRLKDEVNVVKTIELVLQ 465 fruit fly
O14164    416 PKIVIveqvEDENEEEEeaiaaaeNNNGVIQVQGSVVSFLERLDDEFTRSLQMIDPHTPEYIDRLKDETSLYTLLVRSQG 495 Schizosaccharomyce...
P32497    336 IDTYQvnefADPIDFIEdep--keDSDGVKRILGSIFSFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQL 413 Saccharomyces cere...
Q99613    416 PNIFVgeniLEESENLH-------NADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQR 488 human
4UER_c    414 YFEATLKD-----EhdlerALTRPFVKRLDHIYYKSENLIkim---------------etAAWNIIPAQFKSKFTSKDQL 473 Saccharomyces cere...
O49160    401 YFERMGDF-----K-----AAAKVALRRVEAIYYKPQEVYdamrklaelveeeeeteeakEESGPPTSFIVVPEVVPRKP 470 thale cress
NP_188926 363 YLERTGDS-----K-----AASKVAFILVESIYYKPQEVFdamsklad----eeieeaneESGSSSSSFIVVAEIVPRKP 428 thale cress
O02328    464 YVELRNDSgifdkH-----EVCKVYMMRIEHAYYKYQDQNe--------------------------------------- 499 Caenorhabditis ele...
A1ZAX1    466 YFERSGTN-----N-----ERCRIYLRKIEHLYYKFDPEV-------------------------------LKKKRGELP 504 fruit fly
O14164    496 YLERIGVV-----E-----NTARLIMRRLDRVYYKPEQVIr------------------aNEEVAWRSFPPTFDLTITPR 547 Schizosaccharomyce...
P32497    414 YFEATLKDehdleR-----ALTRPFVKRLDHIYYKSENLIkim---------------etAAWNIIPAQFKSKFTSKDQL 473 Saccharomyces cere...
Q99613    489 YLEEKGTT-----E-----EVCRIYLLRILHTYYKFDYKA--------------------HQRQLTPPEGSSKSEQDQAE 538 human
4UER_c    474 DSADYVDNLIDGLSTILS-KQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQLGL 552 Saccharomyces cere...
O49160    471 TFPESSRAMMDILVSLIY-RNGDERTKARAMLCDINHHALMDNFVTARDLLLMSHLQDNIQHMDISTQILFNRTMAQLGL 549 thale cress
NP_188926 429 TFAKSSRAMMDTLVSFIY-KNGDERTKARAMLCDIYQHALMDNFVTARDLLLMSHLQENIQHMDISTQILFNRTMAQLGL 507 thale cress
O02328    500 ---EDAGKLMDYLCNKIYtLDDEKRLRQRAMLCHVYYLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGL 576 Caenorhabditis ele...
A1ZAX1    505 ATTSTSVDVMDKLCKFIYaKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMSHLQDNIDAADPATRILYNRMMANLGL 584 fruit fly
O14164    548 ATTTTPDILIHSLCVYLY-NNGVSLLRTRAMLCHIYHEALQNRFYKARDMLLMSHLQDSVHAADIATQILHNRTMVQIGL 626 Schizosaccharomyce...
P32497    474 DSADYVDNLIDGLSTILS-KQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQLGL 552 Saccharomyces cere...
Q99613    539 NEGEDSAVLMERLCKYIYaKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGI 618 human
4UER_c    553 SAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQcLPYHQHINLDLIDVVFLTCSLLIEIPR 632 Saccharomyces cere...
O49160    550 CAFRAGMITESHSCLSELYSGQRVRELLAQGVSQSRYHEKTPEQERMERRRQ-MPYHMHLNLELLEAVHLICAMLLEVPN 628 thale cress
NP_188926 508 CAFRVGMITESHSCLSELYSGNRVRELLGQGVSQSRDHEKTTEQMLMERRTQ-IPYHMNINLELLEAVYLTCAMLLEVPN 586 thale cress
O02328    577 CAFRHGFIREAHQGLSEIQNTQRAKELLAQAV-GTRQHEKTAEQEKIDRSRQ-VPYHMHINVELMECVYLICSMLLEIPH 654 Caenorhabditis ele...
A1ZAX1    585 CAFRQGNVKDAHHCLVDLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQ-MPFHMHINLELLECVYLVSAMLLEIPY 663 fruit fly
O14164    627 CAFRNGMVQETQYALQDISTTGRVKELLGQGIQAPKFGQFTPDQDRLDKQLV-LPFHMHINLELLECVYLTCSMLMEIPA 705 Schizosaccharomyce...
P32497    553 SAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQcLPYHQHINLDLIDVVFLTCSLLIEIPR 632 Saccharomyces cere...
Q99613    619 CAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQ-VPFHLHINLELLECVYLVSAMLLEIPY 697 human
4UER_c    633 MTAFYSGI 640 Saccharomyces cerevisiae S288C
O49160    629 MAANSHDA 636 thale cress
NP_188926 587 MAANSHDs 594 thale cress
O02328    655 MASCEFEM 662 Caenorhabditis elegans
A1ZAX1    664 IAAHEFDA 671 fruit fly
O14164    706 MAAASSTA 713 Schizosaccharomyces pombe 972h-
P32497    633 MTAFYSGI 640 Saccharomyces cerevisiae S288C
Q99613    698 MAAHESDA 705 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap