Conserved Protein Domain Family
NodS

?
pfam05401: NodS 
Nodulation protein S (NodS)
This family consists of nodulation S (NodS) proteins. The products of the rhizobial nodulation genes are involved in the biosynthesis of lipochitin oligosaccharides (LCOs), which are host-specific signal molecules required for nodule formation. NodS is an S-adenosyl-L-methionine (SAM)-dependent methyltransferase involved in N methylation of LCOs. NodS uses N-deacetylated chitooligosaccharides, the products of the NodBC proteins, as its methyl acceptors.
Statistics
?
Aligned: 5 rows
Threshold Bit Score: 323.314
Threshold Setting Gi: 585572
Created: 20-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8KLG2   9 NYQLLNRELAAPDPWGLDANPFERERHTQMLRLALAQGSISSALEVGCAAGAFTVQLAPHCKRLTVIDVVPQAIERSRRR 88  Rhizobium etli CFN 42
Q98A39   5 DHELLNREMAADDPWRLDGNPFERERHTQILRLSLAQGRVANALEVGCAAGAFTERLAPICQRLTVIDVVEPAITRARLR 84  Mesorhizobium loti
P19441  22 NYHLLHRELAAEDPWRLDANAFEQERHSQMLRLSLSQGPITNALEVGCAAGAFTEKLAPYCKRLTVIDVVPRAIARTRQR 101 Sinorhizobium fredii ...
P26026   6 NHQLLERELAVDDPWRLDTSAFEQQRYAQMLRMSRRDGDAASALEVGCAAGAFTEMLAPLCERLTVVDVMPQAIERTRLR 85  Bradyrhizobium diazoe...
Q07758  16 VKDLLRKDLDARDPWNISSCEYEQKRLHAIMELCLGGRTLGDVLEIGCAAGALTERLSIYSQSLTVVELMTEAIAKAQER 95  Azorhizobium caulinod...
Q8KLG2  89 IRGSPHISWIVSDVQQFSPDERFDLIVVAEVLYYIGGIAEMRGAVRNLVRMLAPDGYLVFGSARDANCRRWGHVAGAETI 168 Rhizobium etli CFN 42
Q98A39  85 MKETPHISWIISDVQQFSSDELFDLIVVAEVLYYVGDLVQIRAAVRNLVGLLAPGGQLVFGSARDANCQRWGHAAGAETT 164 Mesorhizobium loti
P19441 102 MKESSHINWIVADVRQFSTQQLFDLIVVAEVLYYLEDVAAIRTAVHNLVSMLAPSGHMVFGSAIDANCRRWGHVAGAETV 181 Sinorhizobium fredii ...
P26026  86 TGKWSHISWVTCDIQRFSTTEQFDLIVVAEVLYYLRDVVEMHAAIRNLVSMLAPDETLIFGSARDEICQRWGHAAGAETV 165 Bradyrhizobium diazoe...
Q07758  96 VNN-SDIIWHEQDVCQMDLNAKYDTIICTEVLYYIHEKERLRGALENIVQLLRSDGQFIFGSPRNAVCRSWGHLFGAEAV 174 Azorhizobium caulinod...
Q8KLG2 169 LGMLNETLLEVERLECRGESVNEDCLLACFRNPFSA 204 Rhizobium etli CFN 42
Q98A39 165 IAMLNESLTEIECIECRGASINEDCLLALFRKPISA 200 Mesorhizobium loti
P19441 182 IAMLNETLIEVERLYCRGASVNEDCLLSRFQK--ST 215 Sinorhizobium fredii NGR234
P26026 166 IALFNESLSEIERRHCCTGSASEDCLIVRFLKPGGA 201 Bradyrhizobium diazoefficiens USDA 110
Q07758 175 LELAQSRLRIVDLRRINGGLPGQDCVIAKLTRr--- 207 Azorhizobium caulinodans ORS 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap