Conserved Protein Domain Family
DUF745

?
pfam05335: DUF745 
Protein of unknown function (DUF745)
This family consists of several uncharacterized Drosophila melanogaster proteins of unknown function.
Statistics
?
PSSM-Id: 336095
View PSSM: pfam05335
Aligned: 43 rows
Threshold Bit Score: 73.3511
Threshold Setting Gi: 642929779
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q298G9         8 VGKQKTSNIAQKAAQEAKDASDSQISAAEAAARHVKQQLADRALAAANAAEAALAGKQQIVEQLESEVHEGELVVQEEGA 87  Drosophila pseu...
Q16IC8        55 SAGSGLRSIAQGSADQANNAVANQVAAAKQAAYVAQSTLAQAASQAAATAQAALAGKQVLLQGLEQQSLEAHQALESEIQ 134 yellow fever mo...
XP_002054538  35 KINLKSTKIASNAANEATAAKDAQNCASEEASRRTMNRLADKAEQAARAAEAALNGKKQLLEQLEQSQIEADAVVEEVKK 114 Drosophila virilis
XP_001994778  36 aINLNSTQLASNAADEAKAAKDAQKCESVAAGQRAMNQLADKAEQAARTAQAALHGKKQLIDQLEQSQSEAEAVMDEVKK 115 Drosophila grim...
XP_015037400 115 lADNGLRSIAKGSADTAISAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELT 194 Drosophila pseu...
XP_976486     55 SSGAALTSLAHTSALQAKSAVQNQNTAGSQAAFGAKSSLAQAALGAAATAQAALVGKQVIVQGLEHQLHDAEHQLQAEIA 134 red flour beetle
XP_002000039  41 QFNLKSTKMAATAADEASAAKNAQKCAGEEAGQLAMYRLADKAEQAARAAEAALNGKKQLLEQLEQSQCEADAVIEEVKK 120 Drosophila moja...
XP_004923282  76 SRGSGLRTIAVGSANQAKTALGNQAAAAYQAAYVAKNTLAQSAAQASATAQAALAGKQVILSGLEQQVRDAKVALQGEEM 155 domestic silkworm
XP_973262     52 SAGSGLRSIAEGSFNSANDAVNNQDAAGHQAAFVAKNTLAQAAAGASATAQAALAGKQILLQGLEQQLRDAQTALMGEKQ 131 red flour beetle
XP_001983410 114 SIGSGLRSIAQGSADQAHSAVANQHAAAKQAAFIAKNTLAQAASQAAATAQAALAGKQVLLQELEQQAAEAHRALSRELE 193 Drosophila grim...
Q298G9        88 ALQTTQNTAAAAAQAADMAGIQVKTVSEAVKNAQANVANSELVSNGAQQELSEKQQLVEAAKKRVELLIKQLECAKNDFK 167 Drosophila pseu...
Q16IC8       135 QLHQAKKAAKAAQHSAQQALNHVQVLTAALNNAQVAAEHAQQSAAEAAAELASQSQMVGNAKSRVESIEEQLKAARVDFE 214 yellow fever mo...
XP_002054538 115 ALRHSESNIETALRVAQHIKQHLELMQNVLEESRNNLEQVLEVAANANTELQEKQMLIIDSKKRVEDLNHCMQKARADLD 194 Drosophila virilis
XP_001994778 116 ALAKSQSNLETVARISDVVKQLYELLQSLLEDAKKNLAKVLEVSENAQNEVEGKQVLLMDAKKRLEQLNICFQEAKEDLE 195 Drosophila grim...
XP_015037400 195 QLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKSASEAAAELASQIDMVAQAKTKLEHAESQAYGARLDYE 274 Drosophila pseu...
XP_976486    135 QYQHTEHAAHAAQEAAQQAQQQVAALTAALAATQGGAQHAAKAAAEAAGAAAAQHAMIHEAKQRVAHLREELHNALAGLQ 214 red flour beetle
XP_002000039 121 ALASSKCNINTIVRIAASIKNHQEVMQNFLEASKANLERYKEIAACANIEIREKYMILMNVSKREEELKKCMEKAKTDLC 200 Drosophila moja...
XP_004923282 156 QLQQAKRAAQSAAQAAQQAMHQVNVIQAALNAAQATSENANEAASQAAGELGAQTAMVGAARQRLHTLQEQLHGVRIDFE 235 domestic silkworm
XP_973262    132 QLMQAQRSADATMRAAQEARAHVNVLTNTLNAAQTNADHMTQAASEAAGELAAQQSMVGSAKQRVDQLSKQLASVRIDFE 211 red flour beetle
XP_001983410 194 QLKAAKVSAKLAQQTAQSAHNHISVLTAAVNNAKAVVEQAEQTASEVSNQLGSQATMVGQAKNRLEQVEEQLQQARVDFA 273 Drosophila grim...
Q298G9       168 KTKKLAEKAACAAQEAKQRA 187 Drosophila pseudoobscura
Q16IC8       215 ATQEAAHKAAYSAQEAQKNA 234 yellow fever mosquito
XP_002054538 195 RTEEIAKKAENAAEEAKQRI 214 Drosophila virilis
XP_001994778 196 RTESMASKAETAAEEAKQHV 215 Drosophila grimshawi
XP_015037400 275 ETRDAAEKATLSAQEAQLNA 294 Drosophila pseudoobscura pseudoobscura
XP_976486    215 ETEisaqkaaaaahiaqsna 234 red flour beetle
XP_002000039 201 RTEKIAEKAETAAVEATQRV 220 Drosophila mojavensis
XP_004923282 236 ATQSAARKAQAAAQQAQANA 255 domestic silkworm
XP_973262    212 ATRAAAQKAQAAAQAAAANa 231 red flour beetle
XP_001983410 274 ATKESALKAASSAAAAQVNA 293 Drosophila grimshawi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap