Conserved Protein Domain Family
DUF745

?
pfam05335: DUF745 
Protein of unknown function (DUF745)
This family consists of several uncharacterized Drosophila melanogaster proteins of unknown function.
Statistics
?
Aligned: 46 rows
Threshold Bit Score: 72.5797
Threshold Setting Gi: 1004397916
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AANI:GJ22753-PA  69 VPRQKASCIAMKAAQEAKAASDAQLPAAENAAHQVKMQLADKALAAANAAEAALAGKKQIVDQLESEVREGELVVQEESG 148 Drosophi...
EFA07050             51 SSSAELTSLAHSSALQAKTAVRNQQTAGLQAALGAQTGYARAALEAAAAAQVALVAKQVIVQNLEKDIEHAAQQLQAEEA 130 red flou...
EFA07049             54 SSGAALTSLAHTSALQAKSAVQNQNTAGSQAAFGAKSSLAQAALGAAATAQAALVGKQVIVQGLEHQLHDAEHQLQAEIA 133 red flou...
EDW24386            120 LADNGLRSIAKGSADTAISAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELT 199 Drosophi...
Q16IC8               55 SAGSGLRSIAQGSADQANNAVANQVAAAKQAAYVAQSTLAQAASQAAATAQAALAGKQVLLQGLEQQSLEAHQALESEIQ 134 yellow f...
EDV95758            114 SIGSGLRSIAQGSADQAHSAVANQHAAAKQAAFIAKNTLAQAASQAAATAQAALAGKQVLLQELEQQAAEAHRALSRELE 193 Drosophi...
2_pfamImport          4 SSGSGLRSIAQGSANQAHTAVTNQHAAAKQAAFIAKSTLAQAASQASATAQTALAGKQVMTQGLEKQLSESHKSLLEEIE 83 
EFA11524             52 SAGSGLRSIAEGSFNSANDAVNNQDAAGHQAAFVAKNTLAQAAAGASATAQAALAGKQILLQGLEQQLRDAQTALMGEKQ 131 red flou...
WGS:AAPP:GF18340-PA  47 KTNHKTSQMSSKAASDAKAAKDAQSCAAEAAGKQVKNMLADKAAQAAKAAEAALAGKKQLCEELTKNLSETQRVMQEVQR 126 Drosophi...
Q8MSM9               46 KTSMKASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAALNGKKQLLDEYTKSLAETNRVIEEIQR 125 fruit fly
WGS:AANI:GJ22753-PA 149 SLQASQGNCNAATQAAKQAGLQVKSLSDAVKNAQANVLNSEQAANGAQQELIEKQQLVEAAKKRVELLLRQLDGARTDFR 228 Drosophi...
EFA07050            131 QYQQSLQAASAAQNAAQQGQQQLSAATAALAAVQQAVAQTERAAAAASTAAAGQHHMIQEAQQRLARLHEKLHAALAGLE 210 red flou...
EFA07049            134 QYQHTEHAAHAAQEAAQQAQQQVAALTAALAATQGGAQHAAKAAAEAAGAAAAQHAMIHEAKQRVAHLREELHNALAGLQ 213 red flou...
EDW24386            200 QLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKSASEAAAELASQIDMVAQAKTKLEHAESQAYGARLDYE 279 Drosophi...
Q16IC8              135 QLHQAKKAAKAAQHSAQQALNHVQVLTAALNNAQVAAEHAQQSAAEAAAELASQSQMVGNAKSRVESIEEQLKAARVDFE 214 yellow f...
EDV95758            194 QLKAAKVSAKLAQQTAQSAHNHISVLTAAVNNAKAVVEQAEQTASEVSNQLGSQATMVGQAKNRLEQVEEQLQQARVDFA 273 Drosophi...
2_pfamImport         84 QLNMSKKSAKIAQKTAQIAYNHVSILTAALNNAKTLAEHTEQAANEAAAILAAQSSMVGKAKINFENLQEQLNTAKIDLA 163
EFA11524            132 QLMQAQRSADATMRAAQEARAHVNVLTNTLNAAQTNADHMTQAASEAAGELAAQQSMVGSAKQRVDQLSKQLASVRIDFE 211 red flou...
WGS:AAPP:GF18340-PA 127 AISASSCGAKTAKRVRDNVHRNLNAMKCLYGQMRKNVVSLRRVASNAQRDLAEKRSLLNAAKRRVEELNTCLDQGRKDLE 206 Drosophi...
Q8MSM9              126 AIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEAQKDLE 205 fruit fly
WGS:AANI:GJ22753-PA 229 NTQKAAERAAGAAQEAKQRA 248 Drosophila virilis
EFA07050            211 ETKISAQKATAAAQVAQSNA 230 red flour beetle
EFA07049            214 ETEISAQKAAAAAHIAQSNA 233 red flour beetle
EDW24386            280 ETRDAAEKATLSAQEAQLNA 299 Drosophila persimilis
Q16IC8              215 ATQEAAHKAAYSAQEAQKNA 234 yellow fever mosquito
EDV95758            274 ATKESALKAASSAAAAQVNA 293 Drosophila grimshawi
2_pfamImport        164 ATKEAAIKASSAASEAQANA 183
EFA11524            212 ATRAAAQKAQAAAQAAAANa 231 red flour beetle
WGS:AAPP:GF18340-PA 207 RNRENAKKANCAAEDARQRI 226 Drosophila ananassae
Q8MSM9              206 RNKQSAKKANDAAKEAQQRI 225 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap