Conserved Protein Domain Family
DUF745

?
pfam05335: DUF745 
Protein of unknown function (DUF745)
This family consists of several uncharacterized Drosophila melanogaster proteins of unknown function.
Statistics
?
PSSM-Id: 336095
View PSSM: pfam05335
Aligned: 43 rows
Threshold Bit Score: 73.3511
Threshold Setting Gi: 642929779
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121990985   8 VGKQKTSNIAQKAAQEAKDASDSQISAAEAAARHVKQQLADRALAAANAAEAALAGKQQIVEQLESEVHEGELVVQEEGA 87
gi 122067127  55 SAGSGLRSIAQGSADQANNAVANQVAAAKQAAYVAQSTLAQAASQAAATAQAALAGKQVLLQGLEQQSLEAHQALESEIQ 134
gi 968101975  35 KINLKSTKIASNAANEATAAKDAQNCASEEASRRTMNRLADKAEQAARAAEAALNGKKQLLEQLEQSQIEADAVVEEVKK 114
gi 195055755  36 aINLNSTQLASNAADEAKAAKDAQKCESVAAGQRAMNQLADKAEQAARTAQAALHGKKQLIDQLEQSQSEAEAVMDEVKK 115
gi 969471627 115 lADNGLRSIAKGSADTAISAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELT 194
gi 642929777  55 SSGAALTSLAHTSALQAKSAVQNQNTAGSQAAFGAKSSLAQAALGAAATAQAALVGKQVIVQGLEHQLHDAEHQLQAEIA 134
gi 968059872  41 QFNLKSTKMAATAADEASAAKNAQKCAGEEAGQLAMYRLADKAEQAARAAEAALNGKKQLLEQLEQSQCEADAVIEEVKK 120
gi 512893847  76 SRGSGLRTIAVGSANQAKTALGNQAAAAYQAAYVAKNTLAQSAAQASATAQAALAGKQVILSGLEQQVRDAKVALQGEEM 155
gi 91082749   52 SAGSGLRSIAEGSFNSANDAVNNQDAAGHQAAFVAKNTLAQAAAGASATAQAALAGKQILLQGLEQQLRDAQTALMGEKQ 131
gi 195011971 114 SIGSGLRSIAQGSADQAHSAVANQHAAAKQAAFIAKNTLAQAASQAAATAQAALAGKQVLLQELEQQAAEAHRALSRELE 193
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121990985  88 ALQTTQNTAAAAAQAADMAGIQVKTVSEAVKNAQANVANSELVSNGAQQELSEKQQLVEAAKKRVELLIKQLECAKNDFK 167
gi 122067127 135 QLHQAKKAAKAAQHSAQQALNHVQVLTAALNNAQVAAEHAQQSAAEAAAELASQSQMVGNAKSRVESIEEQLKAARVDFE 214
gi 968101975 115 ALRHSESNIETALRVAQHIKQHLELMQNVLEESRNNLEQVLEVAANANTELQEKQMLIIDSKKRVEDLNHCMQKARADLD 194
gi 195055755 116 ALAKSQSNLETVARISDVVKQLYELLQSLLEDAKKNLAKVLEVSENAQNEVEGKQVLLMDAKKRLEQLNICFQEAKEDLE 195
gi 969471627 195 QLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKSASEAAAELASQIDMVAQAKTKLEHAESQAYGARLDYE 274
gi 642929777 135 QYQHTEHAAHAAQEAAQQAQQQVAALTAALAATQGGAQHAAKAAAEAAGAAAAQHAMIHEAKQRVAHLREELHNALAGLQ 214
gi 968059872 121 ALASSKCNINTIVRIAASIKNHQEVMQNFLEASKANLERYKEIAACANIEIREKYMILMNVSKREEELKKCMEKAKTDLC 200
gi 512893847 156 QLQQAKRAAQSAAQAAQQAMHQVNVIQAALNAAQATSENANEAASQAAGELGAQTAMVGAARQRLHTLQEQLHGVRIDFE 235
gi 91082749  132 QLMQAQRSADATMRAAQEARAHVNVLTNTLNAAQTNADHMTQAASEAAGELAAQQSMVGSAKQRVDQLSKQLASVRIDFE 211
gi 195011971 194 QLKAAKVSAKLAQQTAQSAHNHISVLTAAVNNAKAVVEQAEQTASEVSNQLGSQATMVGQAKNRLEQVEEQLQQARVDFA 273
                        170       180
                 ....*....|....*....|
gi 121990985 168 KTKKLAEKAACAAQEAKQRA 187
gi 122067127 215 ATQEAAHKAAYSAQEAQKNA 234
gi 968101975 195 RTEEIAKKAENAAEEAKQRI 214
gi 195055755 196 RTESMASKAETAAEEAKQHV 215
gi 969471627 275 ETRDAAEKATLSAQEAQLNA 294
gi 642929777 215 ETEisaqkaaaaahiaqsna 234
gi 968059872 201 RTEKIAEKAETAAVEATQRV 220
gi 512893847 236 ATQSAARKAQAAAQQAQANA 255
gi 91082749  212 ATRAAAQKAQAAAQAAAANa 231
gi 195011971 274 ATKESALKAASSAAAAQVNA 293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap