Conserved Protein Domain Family
SDA1

?
pfam05285: SDA1 
SDA1
This family consists of several SDA1 protein homologs. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localized in the nucleus.
Statistics
?
Aligned: 131 rows
Threshold Bit Score: 57.6738
Threshold Setting Gi: 74968575
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4QE53       418 MNADLLKDLAEYKNRRgDKGVMMAARALIQLYRDVYPELLPAKLRGSKAGVAD-TAT-------------------RPVY 477 Leishmania major
EGI61363     408 MNEDLLEDLTRYKHYK-ERSVMMAAHSLIGTFRRIMPDLLHKKDKGRPTEANV-MIK-------------------SSKY 466 Panamanian leaf...
3_pfamImport   1 MTEDLLRDLTQYKTRH-DKSVTTAARSLIQLYRRINPAMLLRKDRGKPTEAST-ELQ-------------------TSEY 59 
EFO94057     451 aTEELLRDLSEYKTYK-NKNVSMAARSLITLFRAVNPKLLARRDRGKPQEKDDeEKE-------------------YNGF 510 Caenorhabditis ...
EGT51344     457 aTEELLRDLSEYKTYK-NKNVSMAARSLITLFRAVNPKLLARKDRGRPQEKDEeEKE-------------------YNGF 516 Caenorhabditis ...
Q9NEU2       455 aTEELLRDLSEYKTYK-NKNVSMAARSLITLFRAVNPKLLARKDRGKPQEKDDeDEE-------------------YNGF 514 Caenorhabditis ...
GAA43151     351 iSQDLLSDLVQYRTYK-NKNVVASARSLIRLYREINPSALPRKERGRPTEAQLetmieg-----------qtfsglALSF 418 Clonorchis sine...
CDS26377     414 VDEDLLSDLISYKSYR-NKNVVAAARSLIRLYRQINPALLPKREIGRPTVAIK-EALglegvditdvdalaaadmpARQF 491 Hymenolepis mic...
CDS42844     414 VDEDLLSDLVGYKSYR-NKNVVAAARSLIRLYRRVNPSLLPKREVGRPTEAVK-EALsvdnadtd---alaasngpARVF 488 Echinococcus mu...
XP_004925875 408 iGEDLLRDLVQYKSYK-EKSVMMAARSLIQLYRQSMPELLHKKDRGRPTEASI-ELK-------------------TKKY 466 domestic silkworm
Q4QE53       478 GSKHVYtDIPGLEl--LYHDIENNAGDDES-----------GSESss-sEVDSSSGEWVTDS--DSea---daDDVdGE- 537 Leishmania major
EGI61363     467 GEIRASeFVPGAEv--LYNQPAKNTEETSG-----------SDEEdd-dE------------------------------ 502 Panamanian leaf...
3_pfamImport  60 GQLVVRdYIPGTEa--LPEVPEIDESDPVQ-----------DGWEicsnASDNDGS------------------------ 102
EFO94057     511 ARPKVHdFISGAE---ILDEDDDGGEQGHL-----------SDNEeeesDLDVSDIDTDEVD--TEeeeedddEGApVAk 574 Caenorhabditis ...
EGT51344     517 ARPKVHdFVSGAE---ILDEDADGQEQGHL-----------EEDGee-sDIDVSDVDTDEVD--TDde---eeDGApAAk 576 Caenorhabditis ...
Q9NEU2       515 ARPKVHdFISGAE---ILDEDAADGEQGHL-----------EEDGtd-sELDVSDVDTDDVD--TDd-----dADEpVAk 572 Caenorhabditis ...
GAA43151     419 GQTTAAkFVPGAEalvLAETLAKQSRREDRnnsgsskrmikDDKEtk-nTEERLNAEGVDAD--ANdedseacGEVnKSs 495 Clonorchis sine...
CDS26377     492 GKRNVAtGIAGAEv--LVEKVSGKKRKLDS-----------RQQNdrdcDCHHEHNEEEDDEqeIKppkkrrkLESeTS- 557 Hymenolepis mic...
CDS42844     489 GKKCVAtSIAGAEv--LIEAVTSDTGDGER-------------------------------------------------- 516 Echinococcus mu...
XP_004925875 467 GELETKdYIPGSEv--LLEKEKEKNNDKKK-----------SEKNkk-qKNDSDSEE----------------------- 509 domestic silkworm
Q4QE53       538 FVDVADSSAeeedesedgcpqlvpvhehahsatdrtdadgegphkrarleeaapvsvaSQNSAAlSESS-----ADnede 612 Leishmania major
EGI61363     503 WIDVSENNEee---------------------------------------------igDEEIGDeEISD-----EEisee 532 Panamanian leaf...
3_pfamImport 103 WIDVSSDEEyftaskaii--------------------------------lgvvgmacQQNSKNrYQHEyffffQSkvpt 150
EFO94057     575 KRKVEQKPA--------------------------------------------------ANDDEeDDDE-----SDvdde 599 Caenorhabditis ...
EGT51344     577 KRRVEEEAA-----------------------------------------------------SDsEEEE-----EDvede 598 Caenorhabditis ...
Q9NEU2       573 KKRVEQKSV--------------------------------------------------ENDAEsDADD-----EEiede 597 Caenorhabditis ...
GAA43151     496 RITQKKDDG-------------------------------------------------WIDVPQsSDDD-----ETev-- 519 Clonorchis sine...
CDS26377     558 -----------------------------------------------------------REEESgNDDE-----EGsees 573 Hymenolepis mic...
CDS42844     517 ------------------------------------------------------------PSKRrRVER-----NLervl 531 Echinococcus mu...
XP_004925875 510 WVDVASSAS-------------------------------------------------EIEISDsEESD-----IDenge 535 domestic silkworm
Q4QE53       613 gmdsdgdedgeevvsndeeaedesefgweevsddeesecdeestaeeneeaplslsaalanansgadwfedltdgmsskn 692 Leishmania major
EGI61363     533 eisdeeideneltnestkssisenkddktltlshsgnn---saqntceadsgeqktnkisqkknaltkqekkaqklekka 609 Panamanian leaf...
3_pfamImport 151 e------------------------------------------------------------------------------- 151
EFO94057     600 eedvddeeledvddeeeedve-------------------------------------vddeedeeaedeeeeedvtvns 642 Caenorhabditis ...
EGT51344     599 edvddeeeedvddeedveiede-----------------------------------egeevddeeeeeedseeavtape 643 Caenorhabditis ...
Q9NEU2       598 eemddeeeeieis-----------------------------------------------------deeeeeiddeaeee 624 Caenorhabditis ...
GAA43151         -------------------------------------------------------------------------------- Clonorchis sine...
CDS26377     574 dsaeeseddeg--------------------------------------------------------qkeclsdvsksve 597 Hymenolepis mic...
CDS42844     532 estddvgdeggtrreelgpnteigensileclgdd---------iadsistveeeggrdveaggdedleerkgatnkasn 602 Echinococcus mu...
XP_004925875 536 aeqcdvddtdnm------------------------------------------------------fdrpedtvqkneer 561 domestic silkworm
Q4QE53       693 asSSPRAGSVSSSKAS-SttsISSSRLLTDSDFQKINQLRTQHGSHQSLRGkrkerDV---------------------- 749 Leishmania major
EGI61363     610 kfKSEKNEELTAERKT-KasvISTERLLTDKDFRKIDVALAKQDVTYIKRSvkrthDQie-------------------- 668 Panamanian leaf...
3_pfamImport 152 ---dpteqMDPETKVQ-KaqaISQMRIITQEEFQKVKAQQAAKEVLPAARKrkvvtLNeq-------------------- 207
EFO94057     643 esATDVVVVTPEVDQKkKatkNSMDRILTQEDFKNIRAYQLKKQLIGEKRLkkqmgKGrsnadeqiv------------- 709 Caenorhabditis ...
EGT51344     644 eaPEDAPEDAPEEDPKkKatkNSMDRILTQEDFKNIRAYQLKKQLIGEKRLkkqmgKGrsnaderiv------------- 710 Caenorhabditis ...
Q9NEU2       625 avVEEEASEAVEKDPKlKaskNSMDRIMTQEDFKNIKAYQLKKQLIGEKRLkkqmgKGrsqaderiv------------- 691 Caenorhabditis ...
GAA43151     520 -sDTAKPKIDPSELAS-KaleIASSRIFTQEEFEAMRRYQLNKQKRFAAMGsrnkrKAeddseflei------------- 584 Clonorchis sine...
CDS26377     598 ekGASSAKNKSAKNLTpe--eILATRILTDEDFEAIRKRQAEKKTLFAAAGgrnkkRGtqlvideedlagt------nid 669 Hymenolepis mic...
CDS42844     603 aeENKLVRTKPAKNVAle--eILATRVLTDEDFEAIRKRQAEKQTLFAAAGgrkrkRGeevvieeedlvggyaddsdaad 680 Echinococcus mu...
XP_004925875 562 kiLKAKRKLDNEEKVK-CareIAMETIFTDEDFKRIEAAQIKKNISGVKRKsntniEEee-------------------- 620 domestic silkworm
Q4QE53       750 ---------RSKKRHDLIHgisndldAHDIEHFTeKKr-ETDKQAKIEQAqelRKASS-KFELRRKKKSKLNSTHGEHSK 818 Leishmania major
EGI61363     669 -------tdKGE----LVK-------LSDIENIY-KKr-KHDKAARQKSVkkgQKERD-KFGFKDRRQNPLSSTTNREKR 727 Panamanian leaf...
3_pfamImport 208 --------qSGE----LVA-------LNDIELVH--KrrPHDRESRMALVlagREDRE-KFGRKKAKMDPFASTTNKEKL 265
EFO94057     710 -edmaekleMKRSTDGLAR-------LSDIEHFY--KkkRQTKEERMADItagRADEDyKFGRPK-KNGPHVGRTNEQNS 778 Caenorhabditis ...
EGT51344     711 -eemtekleLKRSSDGLAR-------LSDIEHFY--KkkRQTKEERMADIkegRADEDyKFGRPK-KNGPHVGRTNEQNS 779 Caenorhabditis ...
Q9NEU2       692 -demaekleLKRSSDGLAR-------LSDIEHFY--KkkRQSKEERMADVmagRADEDyKFGRPK-KNGAHVGRTNDQNS 760 Caenorhabditis ...
GAA43151     585 -dseedeadGDKANSQLVT-------MSAITRLV--KrpRQSKAERLEAIqdgRAGRE-KYGYKVNRMNPHASTTNREKS 653 Clonorchis sine...
CDS26377     670 ggedsysdaDPEEASGLVS-------MRNITKLV--KraHSTKADRMESIeegREGRK-KYGFQVNRMNPHASTTNREKR 739 Hymenolepis mic...
CDS42844     681 sdkevnpeeVHG----LVS-------MRNITKLV-KRp-HSTKADRMGTVaegREGRK-KYGFQVNRMNPHASTTNREKR 746 Echinococcus mu...
XP_004925875 621 -------aeSGE----LVQ-------LGAIENIY-KKk-KHDKNARLESVmkgREDRQ-KYGYKDRRKNANCSKTNREKR 679 domestic silkworm
Q4QE53       819 RGKLFQMTKRsqrvaaKLKSSVAdRATRAKEMQKKDIKFRIKRG 862 Leishmania major
EGI61363     728 KGKAFSMLKQ------KLRTKVK-RSFREKQIALKNHLIKQKRM 764 Panamanian leafcutter ant
3_pfamImport 266 KKKPFMMVRE------KMKKKKSgRSFRDKQLALRASLLKR--- 300
EFO94057     779 KKKVFAMVKN------KVRGRNRqRSFRDQQKSLRNYLMRQSGr 816 Caenorhabditis remanei
EGT51344     780 KKKVFAMVKN------KVRGRNRqRSFRDQQKSLRNYLMRQSGr 817 Caenorhabditis brenneri
Q9NEU2       761 KKKVFAMVKN------KIRGRNRqRSFRDQQKSLRHYLMRQSGr 798 Caenorhabditis elegans
GAA43151     654 KGKTFQMIKH------KVRQKAK-RSFRDKQIALRDQLRHMlkh 690 Clonorchis sinensis
CDS26377     740 KNKTFQMIKH------KARRKVK-RSFREKQAALREHLKKFSKn 776 Hymenolepis microstoma
CDS42844     747 KKKTFQMIKH------KVRRKAK-RSFREKQASLREHLLKLSKn 783 Echinococcus multilocularis
XP_004925875 680 KTKNYQMVKH------KAKGKIK-RSFKEKQIAFRNYLIKQKKM 716 domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap