Conserved Protein Domain Family
SH3BP5

?
pfam05276: SH3BP5 
SH3 domain-binding protein 5 (SH3BP5)
This family consists of several eukaryotic SH3 domain-binding protein 5 or c-Jun N-terminal kinase (JNK)-interacting proteins (SH3BP5 or Sab). Sab binds to and serves as a substrate for JNK in vitro, and has been found to interact with the Src homology 3 (SH3) domain of Bruton's tyrosine kinase (Btk). Inspection of the sequence of Sab reveals the presence of two putative mitogen-activated protein kinase interaction motifs (KIMs) similar to that found in the JNK docking domain of the c-Jun transcription factor, and four potential serine-proline JNK phosphorylation sites in the C-terminal half of the molecule.
Statistics
?
Aligned: 28 rows
Threshold Bit Score: 229.45
Threshold Setting Gi: 226524606
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:MICPUN_62998 237 EEVDPRVAGALDEMNEAMMSVNDAETALAAAKRRRRAHKAEGSQKIEETRKKLS-SSVRAAVPFFHAQAVAHMYQVRSIE 315 Micromonas ...
GAA30563          24 iafvisqQSQLDILNQTAPQINQLENNLLAARATYQNTLTEHSSRLNAIGKRLG-KCVQRARPYYDAKAKQAELTREIQR 102 Clonorchis ...
EJW82537          39 akhLNRVHEELEKLNIATDVINKLELQLDEARATFREIQASWSEKLNELSRKYG-SAIAKGRPYYEAKLKERRLREEAQN 117 Wuchereria ...
1_pfamImport       1 ---MMSIRRQLENLNDATDDINSYEMKLEHVKKQFCETQLIFNREISGIPNKLA-KHISKARPFFDLKSREPNLRRFAQQ 76 
P42171             5 DDQLISIRKQLENLNNATDDINSYEMKLETVKKQFCETQLMFNKEMLGIPKKLA-KHISKSRQFFDLKSRESEIRRCVQQ 83  Caenorhabdi...
Q21194            33 TRHLNMIHEELEKLNISTDVINKMEVQLDLARADFRETQVQWSEKLKELSKQYS-SQIAKARPFYELKIKERSLREESQK 111 Caenorhabdi...
XP_015789482      18 SNLDPRIGLKLEELNKWTGRINTLEKSFEEANSKFRITLNESTDRLKLLSTKLG-KSIDDSRPYYEAKDRLTEVQAKCQK 96  two-spotted...
EDQ88305         283 EEVDPRVEIALQDMNDASDAINRLEKELEETKAAFKTAMDQVQIDLRDLANKLGrRNIDKARPYHQALFRARKAHYESRQ 362 Monosiga br...
XP_004365456     284 EIADPRIKGALEALNFATEEINRLERELEASKRTLRVLDRDGAKQLLALAQKLG-KAVDRSRAYYNLKHEASEAHRLAIE 362 Capsaspora ...
CAF99475          18 EEVDPRIQGELEKLNQSTDDINRWESELEDGRQRFRAVLVEAMCKLDGLMKRIG-RAVDDSKPYWEARKVAKQAQIEAQK 96  spotted gre...
jgi:MICPUN_62998 316 CLRAYEKAHDMHAAAKESAAQLEAEMAssaspgkkitgNEGGTFDTDLMIALSDAMSKVVETEIMKKRAEGAHGRMTKLA 395 Micromonas ...
GAA30563         103 ATERYNRANDLLTASCQALSKLENATPt----------GTRQVGDVVSLEALNQCIFKVNEAKREALEAKEQHERLLAMY 172 Clonorchis ...
EJW82537         118 AAIRFERANSMHAVAKQQVKLTQDSLN------------RQRSIEPECLEVLNHHIQRVNEAEQERIAAEEVHRSISERM 185 Wuchereria ...
1_pfamImport      77 AAALFERQKTVVEMAREQLTILHSSLNn----------NDEMDAEKKYIDVIEQQLELVNEAEAECAEAERAHAARVRDL 146
P42171            84 AAAQFERQKTSVEMAREQVQILHNSLNn----------NQELDAEKQYVDVIEQQLELVKEAEGECLKAEKCHASRVRDL 153 Caenorhabdi...
Q21194           112 AAERFERATSILGIAKQQVSLTQESLS------------RQTSVLPECLEVLNHHIQRVREVEEERTAAESLHASKAHAM 179 Caenorhabdi...
XP_015789482      97 AAINFEKACQAYLEAKERINLAEKKFN-----------SAAHEFDTTWQEMLNQANIKLMEAETMKKESERLHHNSMKDF 165 two-spotted...
EDQ88305         363 AAVYFEKASGAYQQAKQKVKATEQQLE------------KGATFDANLQASLNKATQDLMTAFNRKEHADTIHQTKTQTF 430 Monosiga br...
XP_004365456     363 AAKTFEKACSAHDAAKERLAKAERHVL-----------TDNKKIDPVWHDMMATAATQVIESENAKRDASTTHQALLSAA 431 Capsaspora ...
CAF99475          97 ATQEFQRSVEILRAAKETIALAEERLLe----------EDSRQFDSAWQEMLNHATQRVMEAEQSRTRSEAEHKKTAANY 166 spotted gre...
jgi:MICPUN_62998 396 TTAVNESMALRKKIAKSVEKAQPYFAVKSSVEAKARALEEEVVDVEKRVKEMKRRYHAAMDELAKISDEVHARRLREKE 474 Micromonas c...
GAA30563         173 NDTEKTIHNMERRLKMDIKKAQLYFSTKQRFDERMQEAKLRVENCADRVNLCKSLYAEAMLKLEQISESLHDTRRRKTL 251 Clonorchis s...
EJW82537         186 TQLSKEIAQMLEANARSIKKSRHYFEQRIEFTKILEHQKSLILKLESEVRQKKYDYTSSLRNLEQISDAIHEERSLSSV 264 Wuchereria b...
1_pfamImport     147 LQLETTLRRLLQENGPSIKKARPYYDRKEVLTKTMNSQIELMSILENEVQDRKDSYSTSMRALEQISEQIHQERSSQNS 225
P42171           154 LQLEMALRKCLEENGSAIKKSRPYYERKEVLTRTMNSQLELMSILEHEVQERKDSYSDSMRALEQISDQIHQERSSQSS 232 Caenorhabdit...
Q21194           180 LHLAEKIRAMEKDNRYAIKKSRLYFEKRLEFTKILEAQKATILCLEAEVRQKKNDYTTSLRNLERISERIHEERSTGSL 258 Caenorhabdit...
XP_015789482     166 HSAEMVVVDLKKKLKGSLHRSKRYFEEKKRFQKQLGSIKEEIESIISQINCSKARYAATLRELEAISEEIHEKRNCSLL 244 two-spotted ...
EDQ88305         431 LKADRELMELAKARKKIIIKTKPYYESKVQHDKILMGLRQQLLQQERDIKAAKEKYSNSLNTLSSISEEIHERREAEKA 509 Monosiga bre...
XP_004365456     432 AHVSTKLEAAARDIKPRIAKAKPYYDLQNELREQRTKLVDKQTFLAEEIALAKRHVQYSLSNLNDISMEIHEQRRARKA 510 Capsaspora o...
CAF99475         167 NSSISHMRQLEKKLKRSINKSRPYFELKGKYYLQLEHLKILVNERQAKLMSAKAEYRKALRNLESISEEIHAQRRSVAM 245 spotted gree...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap