Conserved Protein Domain Family
DREV

?
pfam05219: DREV 
DREV methyltransferase
This family contains DREV protein homologs from several eukaryotes. The function of this protein is unknown. However, these proteins appear to be related to other methyltransferases (Bateman A pers obs).
Statistics
?
Aligned: 3 rows
Threshold Bit Score: 448.184
Threshold Setting Gi: 75027831
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9H1A3     56 WYVCNREkLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQ 135 human
Q9W1H1     32 WYCLNHE-LPPRFQSKFVPLEPDATTVSWLERTKALSANIWTHLWHALARSILQFFMTQTDINGFLKRGSMFILSEEQFR 110 fruit fly
NP_508880  16 WYQPETS-LSDVAQNLFAASLPDGETQQFLDNSNKIASNFFWQTVRNLGVMILSTIYSKTDINGMTGFGNMFLFSENQFA 94  Caenorhabditis ele...
Q9H1A3    136 RLLKIN-----PdwKTHRLLDLGAGDGEVTKIMSPHFEE--------IYATELSETMIWQLQKKKYRVLGINE-WQntgf 201 human
Q9W1H1    111 KLLVAGgfqpaSgqEPVTLLDIGAGDGEISLRVANTVSElsgsaglrVFATEASWTMRDRLKKLNFNVITEIDgLQ---- 186 fruit fly
NP_508880  95 KFLAIEkeswnS--TDKKVLDLGAGNGDITEHMRPFFEH--------VYATELSSKMRNRLSWKGYNVLSALE-WAetdv 163 Caenorhabditis ele...
Q9H1A3    202 QYDVISCLNLLDRCDQPLTLLKDIRS-VLEPtRGRVILALVLPFHPYVENVGg-KWEKPSEILEIKG--QNWEEQVNSLP 277 human
Q9W1H1    187 NLELILCLNVLDRCFDSFKLLEDIHL-ALAP-NGRAVVALVLPYMHYVETNT--SHLPLRPLLENNGrqASFEEEAARFM 262 fruit fly
NP_508880 164 KFDLVTAFNLLDRHYSPGKLLNDLWNvARRS-NCNVIVSLVLPVSHYVEFNPngRSTRPDNYLNVAG--RTYADHVHHMI 240 Caenorhabditis ele...
Q9H1A3    278 -EVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKP 317 human
Q9W1H1    263 -ELLENCGYRVEAWTKAPYLCEGDLHQSFYWLIDLIVVISK 302 fruit fly
NP_508880 241 vNVFKPANFEVLRWTRLPYLCEGDMNNSAYYLPDAIFLLKP 281 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap