1NG9,1EWR,5YK4,3THW


Conserved Protein Domain Family
MutS_III

?
pfam05192: MutS_III 
Click on image for an interactive view with Cn3D
MutS domain III
This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam00488, pfam05188, pfam01624 and pfam05190. The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain III, which is central to the structure of Thermus aquaticus MutS as characterized in.
Statistics
?
Aligned: 1244 rows
Threshold Bit Score: 53.9421
Threshold Setting Gi: 324313551
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NG9_A                    272 ATRRNLEITQN-LAGg---A-EN----TLASVLDCTVTPMGSRMLK-RWLHMPVRDTRVLLERQQTIGAlQDfTA---GL 338  E...
EEF48286                  544 QTLINLEIFNNnSDG----GlSG----TLFNYLDNCVTSSGKRLLR-KWMCHPLKSVEGINNRLNVVED-L--MTq-sDI 610  c...
WGS:AAFB:cds.EHI_193340A  348 QSIVNLAL----FASkgkeV-EG----TLLHFVDNCFTAFGKRMLReRFLLKPLMDVNKILHRQEVVEF-FL-ENndlID 416  E...
ELA42739                  471 STLVNLDILTNnFD--------StedhSLFKSINYCSTPFGQRLLR-KWIVTPLKNLEMINERRRIAQIfSK-INs-sEI 539  V...
EEQ81696                  393 CSIINLDLLSDkHN--------K----TLFNVINNCSTPFGQRKLQ-SWMLSPLSDGNSIRKRQCLINYfAN-INl-sPI 457  N...
XP_006381708              556 QTLVNLEVFSNsADG----GsSG----TLFNYLDNCVTSSGKRLLR-NWICHPLKHVEGINNRLDVIEN-L--MAr-sEI 622  b...
CBI28088                  568 QTLVNLEIFSNnADG----GsSGk--cTLYKYLDNCVTSSGKRLLR-NWICHPLKDVQGINNRLNVVEH-L--MTn-tET 636  w...
ADG85113                  244 QTLVNLEIFNNnVDG----SpSG----TLYRYLDNCVTLPGKRLLR-KWICHPLKDVEKINHRLDVVDK-L--VDn-aTL 310  t...
XP_009409339              551 QTLLNLEIFSNnIDG----SlSG----TLYKHLDHCITASGKRLLR-RWICHPLKDVTDVNHRLNIVDG-F--IKh-sGI 617  w...
XP_025879134              588 QTLVNLEIFSNnFDG----GsSG----TLYKHLNHCITPCGKRLLR-RWICHPLKDIDAINERLDIVEG-F--IQn-cGL 654  J...
1NG9_A                    339 Q--PVLRQ-VG---DLERILARLALR-----------------TA-RPRD--LAR-MRHAFQQLPELRAQLETVDSAPVQ 391  E...
EEF48286                  611 M--LVISQyLRkipDIERMLGRVKASfqasaslvlpligkkvlRQ-RVKVf-GSL--VKGLRI-GIDLLLL--LQKE-DR 680  c...
WGS:AAFB:cds.EHI_193340A  417 QigTFLRV-IP---DLERLLSQCTS------------------STiTE-SnfIRM--ISGFETCQKLM-----NE---L- 462  E...
ELA42739                  540 V--QSLKE-IG---DIERYYGRLGGC-----------------SP-TFKN--L-KsFVESLKKANSALKILKAIFSDQCE 592  V...
EEQ81696                  458 I--EIFKS-LG---DFERLFSKLQSG-----------------HS-KFRD--L-RtFMEKLNLVVKIYQIIELQICNKNG 510  N...
XP_006381708              623 M--LVIAQyLRklpDLERMLGRVKVSfqasgslalpliskkmlKQ-RVKVf-GSL--VKGLRN-GMDLLLL--LLKE-EQ 692  b...
CBI28088                  637 M--SFIAQcLRklpDLERLLGQVKASvqssallllpffgkkllKQ-RVKVf-GLL--VKGLRV-AIDLLVQ--LQKE-GH 706  w...
ADG85113                  311 ----STAQyLRklpDLDRLLGRVKASiqssealllpligakilKQ-RIKVf-GLL--VKGLRV-GLDLLRL--LQK--EC 377  t...
XP_009409339              618 I--SIIVGyLHrlpDLERLLGRVRSTvgssstlllpfvgervlKQ-RVKGf-GSL--VKGLRI-GIDLLNA--LEKE-DH 687  w...
XP_025879134              655 G--SVTLEhLRkvpDLERLLGRVKSTvglssavllpfvgekilKR-RIKTf-GML--VKGLRV-GIDLLDI--LQRQ-DH 724  J...
1NG9_A                    392 alrekmgEf-----------------------------------AE-LR---DLLE------------------------ 408  E...
EEF48286                  681 -------I-------------------------------------I------SLFS------------------------ 686  c...
WGS:AAFB:cds.EHI_193340A  463 -------K-------------------------------------TiVKdmpEVLQtivldknnlgypnleefisklesi 498  E...
ELA42739                  593 -------Sqsninakhlg-----------------cvqhvldqfEK-VY---LLSD------------------------ 620  V...
EEQ81696                  511 -------PapntikincfvdlydhnnlsvsyaplhdlkkfiqnyQL-KY---YINR------------------------ 555  N...
XP_006381708              693 -------L-------------------------------------I------SSLS------------------------ 698  b...
CBI28088                  707 -------I-------------------------------------M------PSLS------------------------ 712  w...
ADG85113                  378 -------L-------------------------------------T------ASLA------------------------ 383  t...
XP_009409339              688 -------G-------------------------------------I------ISLS------------------------ 693  w...
XP_025879134              725 -------G-------------------------------------I------SALS------------------------ 730  J...
1NG9_A                    409 -------RAIIDTPPVLVRDGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYyiqisRGQ 481  E...
EEF48286                  687 -------K-NFKLPELNGSAGLDKFLSQFEAAVDSEFPNYQNHDV----------------------------------- 723  c...
WGS:AAFB:cds.EHI_193340A  499 ydftsakEEHAITFFNGYNEEIDHAFERRNELENEFAKELVSIKKIFGEAKYVNIGGDDHLIALPIKQYESY-----LKK 573  E...
ELA42739                  621 -------SDILPGNDNDELFVLNRQQVEIQDKLQKFLKSLKKSTGFNDLCYKSIGKEIFQIETGYNN------------- 680  V...
EEQ81696                  556 -------EEIEPGKENSEEIASLINRKEELHAKLEEYLNNVKSNLQCEDINYKNIGKEIYQLEVPKH------------- 615  N...
XP_006381708              699 -------K-NFKLPELLGSNGLEKFLVQFEAAVDSEFPNYQNRDV----------------------------------- 735  b...
CBI28088                  713 -------E-VLKLPMLSGSSGVDKLLTQFEAAIDSDFPNYENHDV----------------------------------- 749  w...
ADG85113                  384 -------K-VVSLPVLDGDNGLDKFLTQFEAAIDSDFPNFQDHNA----------------------------------- 420  t...
XP_009409339              694 -------K-VVNLPTLSGLDELLHQFEVALDDDFPRYQDHKVKD------------------------------------ 729  w...
XP_025879134              731 -------K-AVDIPTLSSLGELIHHFEEAIDDDFPRYQDHSVKD------------------------------------ 766  J...
1NG9_A                    482 SHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLEALQQSASALAELDVLVNLA 559  Esc...
EEF48286                  724 -----------------------TDSEAETLFVLIELFIEKAS----------------CWSEVIQAINCIDVLRSFA 762  cas...
WGS:AAFB:cds.EHI_193340A  574 HAKLPSGYTEANKIKSEARLMSSKVSSIQTEYDLNEKQINDSHHTLFNQLINEVSS-TLVLPRAITNIGLIDCFVSMA 650  Ent...
ELA42739                  681 --QMPSGFYLVSSTKTQRRYYSDELKAITNEFEECEEKIFQSKGSILRRAVDFLKSFSFDIHYSTNYLACIDCLISFS 756  Vit...
EEQ81696                  616 -IKVPDEFFIVSATKSFNRYYTLNLKNLITDYIELEEKIFQCHGSLFFQAVNCLLESESLFFNIISDLSTIDCLISLA 692  Nos...
XP_006381708              736 -----------------------TDSEAGMLSVLIELFIEKAA----------------QWGEVIHAINCIDVLRSFT 774  bla...
CBI28088                  750 -----------------------TDSDAEILSILIELFIEKTT----------------QWLQVIHAINHIDVLRSFA 788  win...
ADG85113                  421 -----------------------TDFDTETLSILMELFIEKAT----------------EWSQLIYAISCVDVLRSFS 459  tomato
XP_009409339              730 -------------------------SDAETLAVLVELFSGKAT----------------EWSHIINALNRIDVLQAFA 766  wil...
XP_025879134              767 -------------------------DDANTLAMLVDLLVGKAS----------------EWSLVINALSTIDVLRSFA 803  Jap...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap