2QYP,5N8K,1QDM,3BQP


Conserved Protein Domain Family
SapB_1

?
pfam05184: SapB_1 
Click on image for an interactive view with Cn3D
Saposin-like type B, region 1
Statistics
?
PSSM-Id: 336044
View PSSM: pfam05184
Aligned: 482 rows
Threshold Bit Score: 27.1667
Threshold Setting Gi: 308500968
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QYP_A          6 VYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLP 43   human
CDS24649      604 TKCEICKEIVDFIYTRIQEDATADQIEKALESVCDYLP 641  Echinococcus granulosus
XP_001603446  633 EACALCEYVLHYLQQAITNPKAEDEVKQVINKVCTKLP 670  jewel wasp
XP_012058359  439 KACTFCEYLLHYIQDAITNPVTEEKMKEVLRKICTKVP 476  Atta cephalotes
EFZ17192      449 QACTLCEYLLHYIQDTITNPTNEEKVKEFFKKVCTKIP 486  red fire ant
XP_011153957  441 EACALCEYLLHYIQDAISNPVTEEKVKQILGKMCKKLl 478  Jerdon's jumping ant
XP_011267621  443 EACALCEYLLHYIQDTVTDPANEEKVKEALGKICKKLP 480  Florida carpenter ant
EHJ69803      551 EICTFCQYFLHYIQVELSDENTEEAIKKVVEDACDVLP 588  monarch butterfly
NP_001036831  548 AACAFCQYFLHYLQVQLSDTRTEDKVKAAVQEACDALP 585  domestic silkworm
XP_002412058  718 FECTFCNYALHFIQNQLVDNVTEARVQEVLDKLCDELP 755  black-legged tick
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap