4DDJ,1M12,3RFI,5U85,1NKL


Conserved Protein Domain Family
SapB_1

?
pfam05184: SapB_1 
Click on image for an interactive view with Cn3D
Saposin-like type B, region 1
Statistics
?
Aligned: 484 rows
Threshold Bit Score: 27.1525
Threshold Setting Gi: 169802308
Created: 23-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4DDJ_A            4 LPCDICKDVVTAAGDMLKDNATEEEILVYLEKT-CDWLP 41   human
CDS39784        124 STCNDCKKIITDLRALVQDNDTKSAIASYLKKAfCYELP 162  Echinococcus multilocularis
GAA57018        369 TLCDDCQKVVQDIRALIADNATSDAIASKLNAViCANIP 407  Clonorchis sinensis
XP_018645371    131 PLCDDCKRLVNDMRRLIEDNSTAAQIEAQLDELvCNNLP 169  Schistosoma mansoni
Q4SJ83           40 DVCKDCTQIFELLSDLLLNADLQKSVLDQIESF-CSHLP 77   spotted green pufferfish
141_pfamImport    1 DVCQDCTQIFELLADMVSNADLQKKMMDGLDHL-CKLLP 38  
XP_008187613    890 PKCTICKDVIHDIKHKIETSPLEKDVQYRLESL-CDVLP 927  pea aphid
XP_004074850     38 DVCQDCTKIFELLEDMLSSPDLQKKILAGIDHI-CALLP 75   Japanese medaka
XP_007236237     41 NMCAECTQIMELFLDMLSKPNTQELIKESLNEL-CRRLP 78   Mexican tetra
XP_007228870     41 DACQDCIHIIELLKDLISEGEFQEKIKGLLEKL-CDSLP 78   Mexican tetra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap