2PJD,4DCM,1DUS,3DMF


Conserved Protein Domain Family
MTS

?
pfam05175: MTS 
Click on image for an interactive view with Cn3D
Methyltransferase small domain
This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases.
Statistics
?
PSSM-Id: 282961
View PSSM: pfam05175
Aligned: 30 rows
Threshold Bit Score: 164.278
Threshold Setting Gi: 81826565
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PJD_A 166 GLTVKTLPGVFSRDGLDVGSQLLLSTLTPH------TKGkVLDVGCGAGVLSVAFARHSPKIR-LTLCDVSAPAVEASRA 238 Escherichia coli
Q8TXG5  27 EYRFLTAPGVFSWRRIDPGTQLLAENMDLEg----vHS--VLDLGCGYGVLGIVAAKELGEGH-VVMTDVNRRAIWLANE 99  Methanopyrus kandleri
Q9X1Z2  31 EYIFKTPSGVYSYGKIDKATQVLLENLKV-------HGKkVLDLGCGYGVIGIVLKKEYPDLE-VYMSDINKRAVEFAKI 102 Thermotoga maritima
1DUS_A  22 KLKFKTDSGVFSYGKVDKGTKILVENVVVDk----dDD--ILDLGCGYGVIGIALADEVKS---TTXADINRRAIKLAKE 92  Methanocaldococcus ja...
Q8DQC6  27 KMTFLTDAGVFSKKIVDFGSQLLLKCLEVNq----gET--VLDVGCGYGPLGLSLAKAYGVQ--ATMVDINTRALDLARR 98  Streptococcus pneumon...
Q81J49  27 RFTFLSDHGVFSKNEVDFGSRLLIEAFQMPd----iKGN-ILDVGCGYGPIGLSLAKEFQGRE-VHMVDVNERALGLAKE 100 Bacillus cereus ATCC ...
Q74L05  30 DLKFTTDAGVFSKLRVDYGSGVLIKAMKNVd----fPKDgILDVGTGYGPMGLFAAKFWPDQE-VDMVDVNERALDLAKR 104 Lactobacillus johnsonii
Q8P4R8 175 DGRFVSRPGVFAWDRIDPASALLVEHLPTT------LAGhGADLGAGFGYLSAEVLARCPKVTaLDVYEAEARALNLARR 248 Xanthomonas campestri...
Q9RVV7 126 GVKVVGLPGVFSAAKPDKATAILLTHLADLd----lTGQrVLDLGCGAGLIGAWAASRGGQ---VTLVDGDLQSVRSSER 198 Deinococcus radiodurans
3DMF_A 197 EYTFHHLPGVFSAGKVDPASLLLLEALQERlgpegvRGRqVLDLGAGYGALTLPLARMGAE---VVGVEDDLASVLSLQK 273 Thermus thermophilus HB8
2PJD_A 239 TLAANGVE---GEVFASNVFSEVK--GRFDXIISNPPFHDGM-QTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYPDV 312 Escherichia coli
Q8TXG5 100 NRRLNDVEd-iTEVREGSLYDPVEd-EEFDRIVSNPPIREGL-D----LVLRIVREAPNHLTEDGELWLVVRRKMGSKRI 172 Methanopyrus kandleri
Q9X1Z2 103 NAKDHNVE---VDIRWGNLYEPWEd-MKFDMIVCNPPIVAGK-K----VWMEIVKSAPEFLEEGGSLQIVAYHNKGGRRI 173 Thermotoga maritima
1DUS_A  93 NIKLNNLDnydIRVVHSDLYENVKd-RKYNKIITNPPIRAGK-E----VLHRIIEEGKELLKDNGEIWVVIQTKQGAKSL 166 Methanocaldococcus ja...
Q8DQC6  99 NAEKNNAK---ATIFQSNIYEQVE--GHFDHVISNPPIRAGK-Q----VVHEIIEKSKDFLETSGDLTIVIQKKQGAPSA 168 Streptococcus pneumon...
Q81J49 101 NAANNKIKn--IRIFQSSVYENVD--GKYAAILSNPPIRAGK-D----IVHEILEKAVEYLVPGGELWIVIQKKQGAPSA 171 Bacillus cereus ATCC ...
Q74L05 105 NAQFNRIDn--VNIYQSDIYEQVD--KKYGLIITNPPIRAGK-K----VVDQILADAKDHLVEKGVLLVVIQKKQGAPSA 175 Lactobacillus johnsonii
Q8P4R8 249 NLQGSAHPa-qLHYHWRDVTAGLV--AQYDFIVSNPPFHTPSrADRPDIGQRFIAVAAQALRPGGQLLLVANRHLPYEQV 325 Xanthomonas campestri...
Q9RVV7 199 TLAANALP---GEVIHSDVDAALGe-RQFDVMLTNPPFHVGR-GVVLDVAREFIATAGRRLVPGGRMFLVANEPLPYEQA 273 Deinococcus radiodurans
3DMF_A 274 GLEANALK---AQALHSDVDEALTeeARFDIIVTNPPFHVGG-AVILDVAQAFVNVAAARLRPGGVFFLVSNPFLKYEPL 349 Thermus thermophilus HB8
2PJD_A 313 ---LDETFGFHEVIAQTGRFKVYR 333 Escherichia coli
Q8TXG5 173 lseMRTVFGSAEVAARGGGYWVLR 196 Methanopyrus kandleri
Q9X1Z2 174 rdfMKEVFGNVEELCKTGGIRVYR 197 Thermotoga maritima
1DUS_A 167 akyXKDVFGNVETVTIKGGYRVLK 190 Methanocaldococcus jannaschii
Q8DQC6 169 kskMEDVFGNCEILKKDKGYYILR 192 Streptococcus pneumoniae R6
Q81J49 172 lkkLEEVFSEVEVVEKKKGYYIIK 195 Bacillus cereus ATCC 14579
Q74L05 176 kklMTKIYGNCEILARDKGYYILM 199 Lactobacillus johnsonii
Q8P4R8 326 ---LNDSFGQVRVAAERDGFKLIA 346 Xanthomonas campestris pv. campestris
Q9RVV7 274 ----LGALGTVREVVREQGFKVLE 293 Deinococcus radiodurans
3DMF_A 350 ---LEEKFGAFQTL-KVAEYKVLf 369 Thermus thermophilus HB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap