Conserved Protein Domain Family
Capsule_synth

?
pfam05159: Capsule_synth 
Capsule polysaccharide biosynthesis protein
This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS and LipB.
Statistics
?
PSSM-Id: 282949
View PSSM: pfam05159
Aligned: 7 rows
Threshold Bit Score: 280.966
Threshold Setting Gi: 81598335
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9911083   90 AVVCFGDTRPYHVIAKRIANENQASFWAFEEGYFR----------PYYITLEKDGVNAFSPLPRRADFFLEQFPKLAQQe 159
gi 81379159  73 DVLLFGDCRAIHRPMHEIARASGVRVHVFEEGYVR----------PHWITMERHGVNGRSLLPRDPAYYLDARRHIPPA- 141
gi 81635134  83 DLVLLGEERSYHRIATAAARKAGVRVFVVEMGYLR----------PDWLTLERGGMSSNSHFPVDPAQILRAATGLPEP- 151
gi 81598335 263 AIALWPSREPKGLRKAI--AQKEAQLYEVEDGFIRsvglgsglhpPLSIVVDKQGIYYDPNQPSDIETLFNE-------- 332
gi 9977929   55 AVVGWGLRPTTHKARAFA-AEHQLPFIALEDGFLRslglgvagypPYSIVYDDIGIYYDTTRPSRLEQLILA-------- 125
gi 81636997  52 CILEWGYKASSKKARHFA-QQHDLPYATIEDGFLRsiglgvdgypPFSLVYDDIGIYYDINQPSRLENLILS-------- 122
gi 81636998  88 AIICFGDTRAYHRIAKIVADKQKISFWVFEEGYLR----------PEYVTLEKGGVNDYSQLPRHANFFLSQAACCSEI- 156
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9911083  160 yKAPTPVHGGFTPMAKNAIRYYIELFRNPRKYPDYIHHRAPNAGHYLKpwsLSILKRLNYYIEDIQIAK--RVEAGKYGK 237
gi 81379159 142 -VPGKPTGYNLYERACHDIRYRMANALYAHRFPHYKSHRPRNGLQEYA---GLAYRAVQQHVRDREAENvtRDLLERKRR 217
gi 81635134 152 -DWQRRYRQSFLAEAAYDLLYNLPNVFFCFLFPGYRRHGIFHPLAEYA---GWIRRLAAGKGEQRRADAliRSLSAKNAP 227
gi 81598335 333 ---------TVFSQELLERAQKLIARIQSAHISKYM---------------------------GTGADK--ALNFPKNKR 374
gi 9977929  126 --------ADTMPSETLAQAQQAMDFILQHHLSKYN--------------------------HAPELSDdhPLRSPSKPE 171
gi 81636997 123 --------QDVLLQEKVDQVEYAIELICTHNLSKYN-------------------------------HAidTPLQNTKRP 163
gi 81636998 157 -SAPEKLAKGFIPLATIAIKYYTKAYFNQDKYPDYQHHRILDLKYYIKlwlTSGIKRAYYYWQDRSFGK--KVAAGKLGD 233
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9911083  238 FFIVPLQVFNDSQVRIHCDFPSVRSFLLHVLSSFAEHAPADTNIIIKHHPMDRGFIDYWRDIKRFIKEhPELKGRVIYVH 317
gi 81379159 218 YYLFPLQLNSDSQIVDHSPFGGICDAIAIVLHSFAENAPDDSWLVIKNHPLDTGLIGYRQFATALATE-LGIEKRMAFID 296
gi 81635134 228 YFVYPLQLETDYQLRAHSPFGSQREAIDGILASFARRAPAGTRLAVKVHPLDNSLISWRRIVADKAASl-GVGDRVLYLD 306
gi 81598335 375 IILVTGQVEDDRSVRLGGG---AVKGNLDLLKRARENEA-DSYIIFKPHPDVEAGHRK-----GFVPQeSAEKYADIIIR 445
gi 9977929  172 TVLIIDQTFGDMAIQYGGA---DASTFELMFQTALNENP-QADIWVKTHPDVLCGKKQ-----GYLTQlAQQHRVHLLAE 242
gi 81636997 164 IVLVVDQTYGDMAVTFGNA---EQSDFLHMLERAIIENP-TAEIWLKTHPDVMCGKKQ-----GYLTEyQQFPRVKVLSE 234
gi 81636998 234 FFLVPLQVYDDSQVRIHCDYESVDAFLKEILESFIHHAPSALNLIIKHHPMDRGFVDYGHVIKQYKTQyPAFKKRIFYVH 313
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9911083  318 DVPLPVFLRHGLGMVTINSTSGLSGLIHNMPVKVLGRAYYDIPGITDQNTLAEFWNH--PTPPDKELFHAYRMYHLNVTQ 395
gi 81379159 297 AGHLPTLLDQCRGVVVINSTVGLSAVHHRRPLVALGTAIYSMPGLTWQGSLADFWTE--AGSPDMNLYQAFLDYVMHHTQ 374
gi 81635134 307 GGNLDSLTEHSCGMVTVNSTAGLHALKQGKPVKVLGKAVFDIAGLTDQQPLDAFWTA--PEAPDPVLSGAMFRLMAASIQ 384
gi 81598335 446 DYPITRLFDQVDAVHVWTSLAGFEALLRHREVICHGTPFYAGWGLTRDLGAIPa-----RRKRKL-----DITELAAVTL 515
gi 9977929  243 DINPISLLQNVDKVYCVTSQMGFEALLCGKPLTTFGLPWYAGWGVSDDRHPEINRLVqtQRRATR-----NLLQLFAAAY 317
gi 81636997 235 DFNSISLLKHVDKVYCVTSHTGFEALLLGKTVVTFGAAWFSGWGLTDDRHAYIRQLKqsKRRAKR-----SLLQLFYAAY 309
gi 81636998 314 DVPTPILLRKGKGMITLNSTSGISALLHRMPVLTLGRASYNFEGLTYQGNLHSFWHN--KGLPEAKVFDAYRKYHLSKTQ 391

                ....*.
gi 9911083  396 INGNFY 401
gi 81379159 375 INGDFY 380
gi 81635134 385 VRGNFY 390
gi 81598335 516 ILYPRY 521
gi 9977929  318 LQYSRY 323
gi 81636997 310 FQYCRY 315
gi 81636998 392 INGSFY 397
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap