Conserved Protein Domain Family
DivIVA

?
pfam05103: DivIVA 
DivIVA protein
The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate mini-cells. Inactivation of divIVA produces a mini-cell phenotype, whereas overproduction of DivIVA results in a filamentation phenotype. These proteins appear to contain coiled-coils.
Statistics
?
PSSM-Id: 309994
View PSSM: pfam05103
Aligned: 57 rows
Threshold Bit Score: 72.2234
Threshold Setting Gi: 122272032
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3AAH7         2 QLPVEIRAKEFKRV-FRG-YEPEAVDNILEMVAQDLEKLLAENQRLKELLEAKEQQLANFKLLEDRINQALIVAEKTAGE 79  Carboxydothermu...
Q6MQK2         3 ITPIDIAHKSFGKK-MMG-LDADEVMDFLQQIAAQMESLIQERNTLKEAIREKELSLMEYKERDQVLKETIATATQMADR 80  Bdellovibrio ba...
Q5FJX9         9 LSAQDILKKQFRSK-VKG-YDPDEVDAYLDQVISDYETFQQIVEDLYGQIGTLQRQLMDEKQKENK-----VSNSSEDEH 81  Lactobacillus a...
Q2FZ83         3 FTPNEIKNKEFSRV-KNG-LEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSYQDVHQSVSDALIQAQKAGEE 80  Staphylococcus ...
CCY61686       2 LTPVDLQQKKFQHG-M-G-YTKKDVDSFFDIVVMSYTELYKSNAELTNQVKTLTDSLVHYRTTESKLQKSLMLAEKNAEE 78  Clostridium sp....
WP_012468499   3 ITPLDIRQQQFKGK-MLGgLDPDDVDSFLQAVAVEMEGLLRENTELKEQANRQTRELSEHAQREKDLRETMLAAQRITDE 81  Geobacter lovleyi
WP_011700431   3 sTSDDIRNKTFRSS-WRG-FDPKEVSAFIEQLTEEIKELKIENAGLKKTIQEHEKELKDYKDRENTIRNVLVNAHNTVEQ 80  Syntrophobacter...
WP_012200374   2 ITPIEIQSKTFKSG-GLG-YDKKDVDSFLREVLLSYEQIYRENMEMKDKISVLTEGIQYYKTIEKTLQKALVLAEKTAED 79  Clostridium phy...
WP_012635869   3 LSPLDIYNKEFKKT-TFG-YSQAQVDEFLDEVGRAYERVLKEVNHLKDENEKLRERLGNYENLEQDLKNMMAAIEETAKE 80  Halothermothrix...
CDC04823       4 LTLEDIANISFPRAnFGG-YRAEDVDAFIDDVQVSYDNVLKESAELKRKLAILAQKVEEYRNEEDSIRNTLLSAQKLADA 82  Clostridium lep...
Q3AAH7        80 IIENAKKEAEIILKTAQNQKGEMISQAKLEVQKIMEEYERLNQEYEKFKRE 130 Carboxydothermus hydrogenoformans Z-2901
Q6MQK2        81 LRQDADREAKLIIADAQQKAEIITRDSRDSLKKMYQEVTELKRVRMQFEAN 131 Bdellovibrio bacteriovorus
Q5FJX9        82 VKTYTPTHRRTSSVASFAEDDNNQ-------GEISTNMAIIQRISTLERKV 125 Lactobacillus acidophilus
Q2FZ83        81 TKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTEDMKRQSKVFRSR 131 Staphylococcus aureus subsp. aureus NCTC 8325
CCY61686      79 ATKNANDKAKIIENDAKIKANNIVHQAREELDRIEDSIEGIKQQYRDYTMA 129 Clostridium sp. CAG:264
WP_012468499  82 MKANAQKEAALIVSEAQLQARRLVDEAERKVADLQARIQDVRRQKLQFEME 132 Geobacter lovleyi
WP_011700431  81 MKTNAEKEARLILSEAELKAEKLVQDAQLRLGKVHEDIAELKRHRIQLESR 131 Syntrophobacter fumaroxidans
WP_012200374  80 TKAQALVTAKNIENEAMTRAQIIVADAKNELEHLHAQTIGLLQQYEKYKLQ 130 Clostridium phytofermentans
WP_012635869  81 KTKQAQKEAEMIINRARVKADNIVKDVKEQIQEEYRTLQELKESRDLFKIR 131 Halothermothrix orenii
CDC04823      83 SVREAKHKAEVIVADATEKAERIILGAQKEADSQKGELGRLKEEVAAFRTK 133 Clostridium leptum CAG:27
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap