Conserved Protein Domain Family
DivIVA

?
pfam05103: DivIVA 
DivIVA protein
The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate mini-cells. Inactivation of divIVA produces a mini-cell phenotype, whereas overproduction of DivIVA results in a filamentation phenotype. These proteins appear to contain coiled-coils.
Statistics
?
Aligned: 57 rows
Threshold Bit Score: 72.6139
Threshold Setting Gi: 122272032
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
bgi:05SSU0487   3 LTALELKDKTFATKFR-GYDADEVDDFLDIVTRDYEDLIRKNHDQELELKNLRERLAYFDEMKESLSKSVLLAQDTAEKV 81  Streptococcus ...
jgi:Sfum_3636   3 STSDDIRNKTFRSSWR-GFDPKEVSAFIEQLTEEIKELKIENAGLKKTIQEHEKELKDYKDRENTIRNVLVNAHNTVEQM 81  Syntrophobacte...
Q6MQK2          3 ITPIDIAHKSFGKKMM-GLDADEVMDFLQQIAAQMESLIQERNTLKEAIREKELSLMEYKERDQVLKETIATATQMADRL 81  Bdellovibrio b...
Q3A6Y2          3 ITPIDIQQHRFKTRPL-GYDKSGVDSFLEQVADELERFHLEVQKLKEELSRTRDSLDEMKQREVTLKETLLTAQRMTDEL 81  Pelobacter car...
jgi:Glov_0414   3 ITPLDIRQQQFKGKMLgGLDPDDVDSFLQAVAVEMEGLLRENTELKEQANRQTRELSEHAQREKDLRETMLAAQRITDEM 82  Geobacter lovl...
Q39WH1          3 ITPLDIQQQQFKGKMLgGLDPHEVDAFLQTVAEEMESLVRENAELKEQCKRATVEMEQMAQQEKNLRETMLAAQKITEEM 82  Geobacter meta...
Q74EU4          3 ITPLDIQQQQFKGKMLgGIDPEDVDSFLQLVAQEMEGLIRENTDLREQCRKAAADAEQTARQERELREAMLAAQKITEEM 82  Geobacter sulf...
jgi:Gura_1166   3 ITPLDIQQQQFKGKMIgGLDSEDVDAFLQVVAQEMETLIRENTELKEQQSRNAAAIAAMEGQESKLRDAVLAAQQISEDM 82  Geobacter uran...
Q5FJX9          9 LSAQDILKKQFRSKVK-GYDPDEVDAYLDQVISDYETFQQIVEDLYGQIGTLQRQLMDEKQKENK-----VSNSSEDEHV 82  Lactobacillus ...
Q2FZ83          3 FTPNEIKNKEFSRVKN-GLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSYQDVHQSVSDALIQAQKAGEET 81  Staphylococcus...
bgi:05SSU0487  82 KVAAEDQAANIIKQADYDAATLLHeakdkaneilrNATDNAKKVVIETEELKNQTRIFHQRLK 144 Streptococcus suis 05ZYH33
jgi:Sfum_3636  82 KTNAEKEARLILSEAELKAEKLVQ-----------DAQLRLGKVHEDIAELKRHRIQLESRLR 133 Syntrophobacter fumaroxidans MPOB
Q6MQK2         82 RQDADREAKLIIADAQQKAEIITR-----------DSRDSLKKMYQEVTELKRVRMQFEANLK 133 Bdellovibrio bacteriovorus
Q3A6Y2         82 KANASKEAEIIVAEAELKGEKIVQ-----------EARNRHMDLLSEIQELRRQKVSFESGLR 133 Pelobacter carbinolicus DSM 2380
jgi:Glov_0414  83 KANAQKEAALIVSEAQLQARRLVD-----------EAERKVADLQARIQDVRRQKLQFEMEFK 134 Geobacter lovleyi SZ
Q39WH1         83 KANAQKEAALLVSEAEVKGEKIVA-----------DAERRLAQLNDQVQEIRRQRLQFESSFK 134 Geobacter metallireducens GS-15
Q74EU4         83 KANAQKEASLIVSEAEVKAEKILV-----------DAERRLGQLNEQLQDLRRQKLQFESAFK 134 Geobacter sulfurreducens
jgi:Gura_1166  83 KANARKEATLLISEAELKGERILA-----------DAEKKLVELNNQIQELRREKLQFETALK 134 Geobacter uraniireducens Rf4
Q5FJX9         83 KTYTPTHRRTSSVASFAEDDNNQ------------------GEISTNMAIIQRISTLERKVYN 127 Lactobacillus acidophilus
Q2FZ83         82 KQAAEKQAEAIIAKAEAQANQMVG-----------DAVEKARRLAFQTEDMKRQSKVFRSRFR 133 Staphylococcus aureus subsp. au...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap