Conserved Protein Domain Family
Nsp1_C

?
pfam05064: Nsp1_C 
Nsp1-like C-terminal region
This family probably forms a coiled-coil. This important region of Nsp1 is involved in binding Nup82.
Statistics
?
PSSM-Id: 309972
View PSSM: pfam05064
Aligned: 23 rows
Threshold Bit Score: 142.058
Threshold Setting Gi: 121988907
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0U9D0       462 LANSTAG-PPPSAqsrLKNKSMDEIITRWAADLSKYQKEFQTQAETVAKWDRALVENSDKVRQLYSKTFQAERDAAEVER 540 Parastagonospor...
Q5B4N1       389 LGASTAG-PPPPAqsrLKNKTMDEIITRWATDLTKYQKEFREQAEKVAEWDRMIVENGSRVQKLYGSTVDAERATQEIER 467 Aspergillus nid...
Q291T0       178 TETKTTDsSAVSNasqLSYNQLEEHINKWTLEFEEQEKIFTEQATQINAWDKLLISNNHKIIELNDAVKKVKNDQQVLDQ 257 Drosophila pseu...
Q7QH06       207 TNTQTTQsAAVAAnqqLKFFQLEEFINKWTLELEEQEKLFTNQATQVNAWDNMLLANGEKIVALNEAVMKVKAEQNAMEQ 286 Anopheles gambi...
Q5KIE7       514 NVEKPSE-PVPNL---LRGKALDDIVEGWNKDLEEQVKEFERQAGEVREWDKILVRNGNQITALRRQVLEAQQTQAAVDE 589 Cryptococcus ne...
XP_011608026 412 ASSLTTT-AAPPV---MTYAQLEALINKWSLELEDQERHFLQQATQVNAWDRMLVENGEKITSLHKEMEKVKLDQRRLNQ 487 torafugu
XP_001629560 283 ASAVPTA-LTSTAp-qLTYKQLEDHINKWALELEDYERTFLDQAAQVNAWDRLLMENGEKITELNSGVESVKAEQKRLDE 360 starlet sea ane...
XP_011390840 478 AVATPSL---------LRGKSMDEILNRWSVSLDSSIKEFSRQAAEVAAWDKVLLKGGDEISALVSALGAAEEKQAGIER 548 Ustilago maydis...
NP_001075137  65 PSTMTVNsIVTPV---MTYGPLESMANNWHYQLQEQEKHYFYQANQFNLWNQALIESGNEIALLYNEVERVKIDQSRLEQ 141 house mouse
XP_010740237 374 attiTTT-AAPPV---MTYAQLEGLINKWSLELEDQERHFLQQATQVNAWDRMLVENGEKITALHKEMEKVKLDQRRLNQ 449 large yellow cr...
Q0U9D0       541 QLTMMEENQQELDSYLDRYEKEIENLMkMHGVSGKS-----DGL 579 Parastagonospora nodorum SN15
Q5B4N1       468 QLASVEGQQDELSSWLDRYEREVDEMM-SKQVGPGEslqgpDQE 510 Aspergillus nidulans
Q291T0       258 ELEFIATQHKELEESLAPLEKEFVALP-------RV-----DME 289 Drosophila pseudoobscura
Q7QH06       287 ELEFITAQHTELEECIVPLEQELSRIG-------QI-----DLE 318 Anopheles gambiae str. PEST
Q5KIE7       590 PLNYFEAQQNQLESMLDVYEKEIAKMS-NDSTRPLA-----AKM 627 Cryptococcus neoformans
XP_011608026 488 ELDFILSQQKELEDLLCPLEESVKEQS-GTIYMQNA-----DEE 525 torafugu
XP_001629560 361 ELNFISAQQRELEDLLKPLEDELKKNSvGTSQLQHA-----DRE 399 starlet sea anemone
XP_011390840 549 TLDYLESSQSDLTSLVTDYEAQIESLL-PGLTSQINlt-saDVE 590 Ustilago maydis 521
NP_001075137 142 ELDIILFQQKELEQMLTPIEELLKEQN-GPLNMMYV-----NKE 179 house mouse
XP_010740237 450 ELDFILSQQKELEDLLCPLEESVKEQS-GTIYMQNT-----DEE 487 large yellow croaker
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap