3U84


Conserved Protein Domain Family
Menin

?
pfam05053: Menin 
Click on image for an interactive view with Cn3D
Menin
MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumor suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23.
Statistics
?
Aligned: 7 rows
Threshold Bit Score: 820.372
Threshold Setting Gi: 194156063
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3U84_A                 2 GLKAAqktLFPLRSIDDVVRLFAAEL-----GREEPDLVLLSLVLGFVEHFLAVNR------------------------ 52   human
Q9VM47                18 VIDAS---LFPLKSTADVINLFRRALt----SGIEPDLTLLSIVVGYIELSLTTGEaaaqaaqaaaaava--------ag 82   fruit fly
WGS:AANI:GJ16255-PA   19 IIDAS---LFPLKSTSDVVNLFRRALt----SPIEPDLTLLSIVVGYIELSLTTGEaaqaaqaaq--------------- 76   Drosop...
Q503J8                 2 GIRSTqkkHFPLRGIDGVVQLFESEL-----NSPEPDLALLSLVLGFVEHFLAVNR------------------------ 52   zebrafish
XP_008707346           2 GLKAAqktLFPLRSIDDVVRLFAAEL-----GREEPDLVLLSLVLGFVEHFLAVNR------------------------ 52   polar ...
XP_023202917           2 GLHSTqkkFFPLKGIDGVVQLFDSEL-----RKSEPDLALLSLVLGFVEHFLAVNR------------------------ 52   southe...
WGS:AAQB:GK24291-PA   20 LIDAS---LFPLKSTSDVVNLFRRSLtetsnSGIEPDLTLLSIIVGYIELSLTTGEaaaqaaqaaaqaaasaatdpcltn 96   Drosop...
3U84_A                53 ------------VIPTNVPeltfqpspapdppggltyFPVADLSIIAALYARFTAqIRGAVDlslYPREGGVSSRELVKK 120  human
Q9VM47                83 disqattggndiIMGNSVP------------------FPVVTHELIAGLYKKFQT-ILSVVE---KPKPHRQATREVIKK 140  fruit fly
WGS:AANI:GJ16255-PA   77 ---aalgggsdvIMGNSVP------------------FPVVTHELIAGLYKKFQT-ILSVVE---KPKPHRQATREIIKK 131  Drosop...
Q503J8                53 ------------VVPVNVPgvrfeplq---pdslnscFPTVELNLLSALYERFMAqIRGAVDmsqYRKPSGASSRELVKK 117  zebrafish
XP_008707346          53 ------------VIPTNVPeltfqpspapdppggltyFPVADLSIIAALYARFTAqIRGAVDlslYPREGGVSSRELVKK 120  polar ...
XP_023202917          53 ------------VIPINVPgvrfeple---pdcptscFPTVELGMISALYERFTAqIRGAVDlsqYRRTASGSSRELVKK 117  southe...
WGS:AAQB:GK24291-PA   97 stgatassnhdvIMGNSVP------------------FPVVTHELIAGLYKKFQT-ILSVMD---KPKPHRQATREIIKK 154  Drosop...
3U84_A               121 VSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPN-GEQTAEVTWH 199  human
Q9VM47               141 VSDVIWNSLIRSSYKDRAHLQNLYSYLSGNKLDCFGVALAVVAGCQLLGYKDVRLAISEDHAWVVFGQK-RVETIEVTWH 219  fruit fly
WGS:AANI:GJ16255-PA  132 VSDVIWNSLIRSSYKDRAHLQNLYSYLSGNKLDCFGVALATTAGCQLLGYRDVRLAISEDHAWVVFGQK-HVESIEVTWH 210  Drosop...
Q503J8               118 VSDVIWNSLSRSYFKDRAHIQSLFSLITGTKLDSSGVAFAVVAACQVLGLKDVHLALSEDHAWVIFGKG-GEETAEVTWH 196  zebrafish
XP_008707346         121 VSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPN-GEQTAEVTWH 199  polar ...
XP_023202917         118 VSDVIWNSLSRSYFKDRAHIQSLFSLITGTKLDSSGVAFAVVAACQVLGLKDVHLALSEDHAWVIFGKN-GEETAEVTWH 196  southe...
WGS:AAQB:GK24291-PA  155 VSDVIWNSLIRSSYKDRAHLQNLYSYLSGNKLDCFGVALAVVAGCQLLGYKDVRLAISEDHAWVVFGQKpRLETIEVTWH 234  Drosop...
3U84_A               200 GKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMA 279  human
Q9VM47               220 GKGSEDKRGQDIRPGIESGSWLYLGGLAVVCERGMEVAAICAALNISLTSNSDCVEVAELQQQLLWLLYDLGHLKRYPMA 299  fruit fly
WGS:AANI:GJ16255-PA  211 GKGSEDKRGQDISAGIESGSWLYLGGLAVVCERGMEVAAICVALNISLSANSDCVEVAELQQQLLWLLYDLGHLKRYPMA 290  Drosop...
Q503J8               197 GKGNEDRRGQTVSAGINERSWLYLKGSYMKCNRNMEVAFMVCAINPSLDLHTDSTELIQLQQRLLWLLYDRGDLERYPMA 276  zebrafish
XP_008707346         200 GKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMA 279  polar ...
XP_023202917         197 GKGNEDRRGQTVTAGVSEKSWLYLKGSYMKCDRNMEVAFMVCAINPSLDLHTDSSELLQLQQKLLWLLYDRGDLDRYPMA 276  southe...
WGS:AAQB:GK24291-PA  235 GKGSEDKRGQDINAGIESGSWLYLGGLAVVCERGMEVAAICAALNISLTANSDCVEVAELQQQLLWMLYDLGHLKRYPMA 314  Drosop...
3U84_A               280 LGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNY-CREDE 358  human
Q9VM47               300 LGTLGELEEIHRTHPSISCEQLYREAIESARTHYRNHHVYPYTYQGNYYNRLLKYRDAFAAWANAADVIRLYTYqCRDDE 379  fruit fly
WGS:AANI:GJ16255-PA  291 LGLLGELEEIHRTHRSISCEQLFREAIDSARNYYHNHHVYPHIFQGNYYNRLLKYREAFAAWANAADVIRLYTYqCRDDE 370  Drosop...
Q503J8               277 MGTLADLEDQEPMTGKESPLSIHLKAVESAKKYYNNEHIYPYMYLAGYHYRHRDVREALGSWAEAASVMQDYNY-CREDE 355  zebrafish
XP_008707346         280 LGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNY-CREDE 358  polar ...
XP_023202917         277 MGTLADLEDQEPIPGKENPLQIHLKAVGSAQKFYNNEHIYPYMYLAGFHYRHRNVQEALKAWAEAAQVMQEYNY-FREDE 355  southe...
WGS:AAQB:GK24291-PA  315 LGTLGELEEINPTHRTITCEQLYREAIESSRLYYRNHHVYPYTYQGNYYNRLLKYRDAFAAWANAADVIRLYTYqCRDDE 394  Drosop...
3U84_A               359 EIYKEFFEVANDVIPNLLKEAASLleageerp-----geqsqgtQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLH 433  human
Q9VM47               380 EIYKELLDIANELIPYVMKTESSG--------------------HSARSILRDSEVFANLLRFYDGICQWEEDSLTPILH 439  fruit fly
WGS:AANI:GJ16255-PA  371 EIYKELLDIANELIPYVMKTESSG--------------------HSARSILRDAEVFANLLRFYDGICQWEEDSLTPILH 430  Drosop...
Q503J8               356 EIYKEFFDIANDVIPTLLKETAAAaesegtdea---ekedqpreAAALTALQDPECFAHLLRFYDGICKWEEGSPTPVLH 432  zebrafish
XP_008707346         359 EIYKEFFEVANDVIPNLLKEAASLleageerp-----geqtqgaQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLH 433  polar ...
XP_023202917         356 EIYKEFFDIANDVIPTLLKETATAdgpgedgdgaegpdkengkqMTAISALQDPECFAHLLRFYDGICKWEEGSPTPVLH 435  southe...
WGS:AAQB:GK24291-PA  395 EIYKELLDIANELIPYVMKSESSG--------------------HSARSILRDAEVFANLLRFYDGICQWEEDSLTPILH 454  Drosop...
3U84_A               434 VGWATFLVQSLGRFEGQVRQKVRIV--------------------------------SGT---VAG-TARg--------p 469  human
Q9VM47               440 IGWAKPLVNNITKFDYDIRSQVVIKlpedleaeqakaelaraeqeakeakeskeaagSEA---MEGnNNRmat----kee 512  fruit fly
WGS:AANI:GJ16255-PA  431 IGWAKPLVTNITKFDYDIRSQVVIKlpedleaeqaaaleak-kaaaaaaaattaaaaAEAtlhLEGnNNNnnntlakkde 509  Drosop...
Q503J8               433 VGWATYLVQSLSRFDAQIRQKVSIItkdtepv------------------ddddqssEDL---REG-RRRgprresklde 490  zebrafish
XP_008707346         434 VGWATFLVQSLGRFEGQppapppphpaspppplqardtvtselaavkivkldpgddisslqqeitilrecrhpnvvayig 513  polar ...
XP_023202917         436 VGWATYLVQSLSRFDSQVRQKVSIItkepecq------------------ddddqssEDP---REG-RRRgprreskled 493  southe...
WGS:AAQB:GK24291-PA  455 IGWAKPLVNNITKFDYDVRSQVMIKlpedleaeqqqaaaa---aaaaeaakqedakrEAAllqLEGnNNIninsmvkkde 531  Drosop...
3U84_A               470 EGGSTAqVPAPTA------------------------------------------------------------------- 482  human
Q9VM47               513 KSKNSE-LPTTLAdltaacgekilnpdfllqgggqpfadqkqqpsggesdnpelhnnnnnsnsnnnnnnhnadkkeaaat 591  fruit fly
WGS:AANI:GJ16255-PA  510 KSK-SE-LPTTLAdltaacgekilnpdfllqgggqpfadqkqqaaaeqtts----------sdlshnnnnniktssskea 577  Drosop...
Q503J8               491 PAGSASpNPALPAqnqnpvpkkvggeggrr-------------------------------------------------- 520  zebrafish
XP_008707346         514 sylrndrlwicmefcgggslqeiyhatgpleerqiayvcrealkglhhlhsqgkihrdikganllltlqgdvkladfgvs 593  polar ...
XP_023202917         494 QSSSPPtAPTSPPsqqpaaapqpkkvgdgav------------------------------------------------- 524  southe...
WGS:AAQB:GK24291-PA  532 KSKPSEqLPTTLAdltaacgekilnpdfllqggnqpfaeqkqqnnsagneptean---nnnsshnnsekeaktsstitat 608  Drosop...
3U84_A               483 -------------------SPPPEGPV-------------------------------------------LTFQSEKMKG 500  human
Q9VM47               592 ttnatttsngsgtsvqlpvSSEANNAGqaqsqvqindqlgkpqhkea---kkeetsddydpfeimlkrpvITLYSQKMKG 668  fruit fly
WGS:AANI:GJ16255-PA  578 dkeatttsngggsgsnlthSPSTEAQMqspsqsqhkeakleessqlelasskpaavddydpfeimlkrpvITLYSQKMKG 657  Drosop...
Q503J8               521 --rssastrgkeadgknepSSPS--PIpspsqpp-----------------------------avqggpvVVFHSEKMKG 567  zebrafish
XP_008707346         594 geltasvakrrsfigtpywmapevaaverkggynelcdvwalgitaielgelqpplfhlhpmralmlmskssfqpprlrd 673  polar ...
XP_023202917         525 --rrrssqglragetdgtpKSPSSESVssplsqqla--------------------------spcpagpvVVFQSEKMKG 576  southe...
WGS:AAQB:GK24291-PA  609 iatattststtsnggssssSGNPNATIetpqepkeakleekqkqievk-apptptddyeeyvqimlkrpvITLYSQKMKG 687  Drosop...
3U84_A               501 MKELLVATKINSSAIKLQLTAQSQVQMK------KQKVSTPSDYTLSFLKRQRK 548  human
Q9VM47               669 LKDLLLAEKLNTHAISLQVTAQSVASRKvr---gVEKHSATISATITAISSSSG 719  fruit fly
WGS:AANI:GJ16255-PA  658 LKDLLLAEKLNTHAISLQVTAQSVASRKvrgggaDSRQPATISATITAIASTEG 711  Drosophila virilis
Q503J8               568 MKELLSAAKVNSSAIKLQLTAQSQVQMK------RQKPTASGDYTLSFMKRPRK 615  zebrafish
XP_008707346         674 ktrwtqnfhhflklaltknpkkrptaekllqhpfttqhlpralltqlldkandp 727  polar bear
XP_023202917         577 MKELLCAAKVNSSAIKLQLTAQSQVQMK------RQKSTPAGDYSMSFMKRQRK 624  southern platyfish
WGS:AAQB:GK24291-PA  688 LKDLLLAEKLNTHAISLQVTAQSVASRKvrg-vaEKQQTATISATITAITTESG 740  Drosophila willistoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap