4LT6,1FA0


Conserved Protein Domain Family
PAP_central

?
pfam04928: PAP_central 
Click on image for an interactive view with Cn3D
Poly(A) polymerase central domain
The central domain of Poly(A) polymerase shares structural similarity with the allosteric activity domain of ribonucleotide reductase R1, which comprises a four-helix bundle and a three-stranded mixed beta- sheet. Even though the two enzymes bind ATP, the ATP-recognition motifs are different.
Statistics
?
PSSM-Id: 335942
View PSSM: pfam04928
Aligned: 117 rows
Threshold Bit Score: 340.983
Threshold Setting Gi: 74831963
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4LT6_A         26 GITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSE-SKn-LPPSVVATVGGKIF 103
gi 122053777   14 GITDPVSHEGPTNNDLKASRELLNLLKSHNLYETEEGKKRREDILESLNRLLQQFVRRQAKiTRg-LTDQEASQVSGKLL 92
gi 122047328    6 GPTKPLEVPPAQPRDLAESKRLCETMATVVADRVRE-------AIDLIELTAHRLVDQITA-E--------PEERWVRAY 69
gi 74831963     6 GPTKPLEVPRPQDHDYDESEMLYGVLAECPSISPNP-------VLTLVESMALRIVQRHSQ-N--------TQEQWARAY 69
gi 167998971    8 GVTEPISTADPTEVDYVNTKQLEECVKGLALQGSREEEVRREEVLGRLDELVNVWVKSMSR-KKg-LNDEYVREARCKIF 85
gi 1000973500  18 GVTKPISTAGPTEADIQRTRELEKLLGDSGLYESKDEAVKREEVLARIDQV--QFSRFLSIh----YIIDFIK------F 85
gi 731406727   12 GLTKPISYVKPTDFHIRRSFELEKVLWDGGVYQVEEEARKREEIIEKLRVVVKSWVKQVTR-WKg-YTDKMVENANALIV 89
gi 209878111   25 GVTPPISESLPTPQDYKLTEQLIIAMRSENLYETVEGMKKREQILASLNKMVREWIYEASL-EHs-MSEEESLTAGGGIY 102
gi 156082541   14 GITDPVSTDGPSESDREDTAELMKFLVAQNLFETEDGKRKRERVLESLNRVLQQFVRKNAI-KQlgIPDDEASKISAKLL 92
gi 723753648   19 GVTKPLSLAGPTETDLQRNAELEKFLRESELYESEEETARREEVLRRLDQIVKQWVKQLTR-QRg-YIDQMVEDANAIIV 96
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4LT6_A        104 TFGSYRLGVHTKGADIDALCVAPRHVER-S-DFFQSFFEKLKHQDGIRN--LRAVEDAFVPVIKFEFDGIEIDLVFARLA 179
gi 122053777   93 TFGSYRLGIVAPDSDIDVLCLCPRSVTR-E-SFFSDFYNTLNKVDGISK--LQAVPDAYTPVIKLYFYDISIDILFANLD 168
gi 122047328   70 PFGSCGLGASVADSDLDIVLFCSFKVTA-E-VFFREFPPLLQP--VVGNvvLVP---ARVPVVKFSYSGTSVDVVFVSAA 142
gi 74831963    70 PFGSCGLSASVAESDLDVALICPSVLTT-D-IFFDEFPRLLYN--SVGPvsVVA---ARVPVVKFEYRGTAVDVVFVSVG 142
gi 167998971   86 TFGSYRLGVHGPGADIDTLCVGPCYVTR-EeDFFVELHDLLQKTEGVTE--LHTVPDAHVPVMSFEFNGIPIDLLYARLP 162
gi 1000973500  86 EYGQ----VHGPGADIDTLCVGPSYVNR-EeDFFFVLHNILAEMEEVTE--LQPVPDAHVPVMRFKFDGISIDLLYASIS 158
gi 731406727   90 TFGSYRLGVHGPGSDIDTLCIGPSYVNR-EeDFFIRLHNILIGMEGVSE--LLPIPHAHVPVMKFKFEGVSIDLLYASVS 166
gi 209878111  103 TFGSYRLGVVAAGSDIDTLCIVPRHITR-D-SFFTFFLAKLQQDIHITK--IQPVPDAYTPIIKMVYYGIEMDLLFACLN 178
gi 156082541   93 TFGSYRLGIVAPNSDIDCLCLCPQSVTR-E-SFFTDFYNALKLLPNITK--LHAVPDAYTPVIKLIYDGIDIDLLFANLP 168
gi 723753648   97 TFGSYRLGVHGPGADLDTLCVGPCYVNReE-DFFILLHDILAEMEEVCE--LQPVPDAHVPVMKFKFQGISIDLLYASIT 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4LT6_A        180 IQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKE-TFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLV 258
gi 122053777  169 APTVSPHINVLDDNILRNMNDSTVRSINGCRVASYILDSVPNKN-YFRTTLRFIKLWASRRKIYSTVVGYLGGVAWAILT 247
gi 122047328  143 LAAPPTTEQLLDDSFLLQVARDTRHSVNGLRTVLEVKRRLPVAYdVFTTVLKSVKLWAMRRKVYGNLYCYPSGVVLAIMV 222
gi 74831963   143 LPQPPTEEQMLDDSFLLKVARETRPSANGIRFTFEIKRRLPVPYdVFTAVLKTVKLWAMRRMVYGNVYTYPNGAVLAIMV 222
gi 167998971  163 LWVIPEELDILQDTILQNVDEQSVRSLNGCRVTDRILRLVPNME-HFRTTLRYVKLWAKRRGVYSNVIGFLGGVNWALLV 241
gi 1000973500 159 LLVVPEDLDISDVSVLYDVDEPTVRSLNGCRVADQILKLVPNVE-HFRTTLRCLKFWAKRRGVYSNVTGFLGGVNWALLV 237
gi 731406727  167 HLVVPDDLDISNESILYEADEPTVRSLSGCRVADQILRLVPNVE-HFRTTLRCLKFWAKRRGVYSNVTGFLGGVNLALLV 245
gi 209878111  179 LSRIPSDLNTLDDDLLRNVDEKTARSLNGCRVNDMILQLVPNKE-SFRTALRFVKHWSKSRGIYSNVLGYLGGISWAILT 257
gi 156082541  169 AQTVPEEIDVLDDAILRNMNEATARSINGCRVAALILASVPNKD-NFRTTLRYVKLWANRRGLYTTVMAYMGGVAWAILT 247
gi 723753648  174 LLVIPEDLDISDQSVLCNVDGPTVRSLNGCRVADRILKLVPNAK-HFRTTLRCLKFWAKRRCVYSNVTGFLGGVNWALLV 252
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4LT6_A        259 ARTCQLYPNAAASTLVHKFFLVFSKWEW---PN-PVLLKQPeE--SN---L-NLp----VWDPRVNPSDRYHLMPIITPA 324
gi 122053777  248 ARVCQLYPNCAPNQLIEKFFRVYSVWQW---EC-PVTLCKIkE--PPn-iPgLMsf--kVWDPRVNPQDRHHLMPIITPA 318
gi 122047328  223 ARICQVMPASHPNVLLRFFFLFYTQWLSrhdRIsPVYITTSlE--SRgriP--Glp--dSWDP-RRDACRDDLLPVINPA 295
gi 74831963   223 ARVCQVLPSSHPSTLLRFFFLFYTQWMSrhdRIsPVYLTATlE--GRgriP--Glp--dSWKP-SKDKICCDLFPVISPA 295
gi 167998971  242 ARICQLYPNAVPSVLLSRFFRVYKQWRW---PN-PVMLCAIeE--Gp---L-GLp----VWDPRRNPRDRSHLMPIITPT 307
gi 1000973500 238 ARICQLYPNAIPSMLVSRFFRVYTQWRW---PN-PVMLCPIeE--DE---L-GFs----IWDPRKNPRDRTHHMPIITPA 303
gi 731406727  246 ARVCQLYPNANPSMLVSRFFRVYTQWHW---PN-PVMLCPIeD---Ke--L-GFp----VWDPRRNPLDRNHHMPIITPA 311
gi 209878111  258 ARICQLYPNSAPNQIINRFFYVYKAWQW---KN-PVILCEIkEvpKNs--P-GLmg-frVWNPNTNPQDRAHLMPIITPA 329
gi 156082541  248 ARVCQLYPNFLPNQLIQKFFRVYAQWNW---KC-PVMLCKIkE--VPn--I-PGymsfkVWDPRNNPTDRQHLMPVITPA 318
gi 723753648  253 ARICQFYPNAIPSMLVSRFFRVYTQWRW---PN-PVMLCPIeE--DE------Lgf--lVWDPRKNPKDRTHHMPIITPA 318
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*..
4LT6_A        325 YPQQNSTYNVSTSTRTVMVEEFKQGLAVT--DEILQGKSDWSKLLEP 369
gi 122053777  319 FPSMNSTHNVTATTKRVITEELMRALEIFktSNLTNVEL-WEKVLEE 364
gi 122047328  296 YPYVNDARNVGRCSLEVFYAELTYAYRLL--SNLET-P--LEAIWEP 337
gi 74831963   296 YPYVNDASSVGRCGLEALYSEITRVQCIL--TEARTLP--LEEMWEP 338
gi 167998971  308 YPCQNSSFNVSNSTLRVMTEEFKRGDSIC--DSLDSKVADWSKLFEP 352
gi 1000973500 304 YPCMNSSYNVSTSTLRVMMEQFQYGNKIC--EEIELIKTQWATLFEP 348
gi 731406727  312 YPNMNSSYSVSTSTLEAMMKQFHTANKIC--NDIELNKSSWGALFEP 356
gi 209878111  330 FPSMNSTHNVTQTTLRVITEELQRGSELV--KEIENERAQWSDLWSP 374
gi 156082541  319 FPSMNSTHNITLTTKRILTDEFKRANDLL---KVNAKGAQMKNIWER 362
gi 723753648  319 YPCMNSSYNVSPSTLRVMMDQFQIGNKIS--EDVELNKSQWPALFEH 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap