1Q78


Conserved Protein Domain Family
PAP_central

?
pfam04928: PAP_central 
Click on image for an interactive view with Cn3D
Poly(A) polymerase central domain
The central domain of Poly(A) polymerase shares structural similarity with the allosteric activity domain of ribonucleotide reductase R1, which comprises a four-helix bundle and a three-stranded mixed beta- sheet. Even though the two enzymes bind ATP, the ATP-recognition motifs are different.
Statistics
?
Aligned: 114 rows
Threshold Bit Score: 333.285
Threshold Setting Gi: 74831963
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q78_A    21 GITSPISLAAPKETDXLLTQKLVETLKPFGVFEEEEELQRRILILGKLNNLVKEWIREISE-S-KNLPQSV-IENVGGKI 97  cattle
EEA06148  25 GVTPPISESLPTPQDYKLTEQLIIAMRSENLYETVEGMKKREQILASLNKMVREWIYEASL-E-HSMSEEE-SLTAGGGI 101 Cryptosporidium mur...
EDO05187  14 GITDPVSTDGPSESDREDTAELMKFLVAQNLFETEDGKRKRERVLESLNRVLQQFVRKNAIkQ-LGIPDDE-ASKISAKL 91  Babesia bovis
Q4N9S7    14 GITDPVSHEGPTNNDLKASRELLNLLKSHNLYETEEGKKRREDILESLNRLLQQFVRRQAKiT-RGLTDQE-ASQVSGKL 91  Theileria parva
EER05794  13 GVSPPVSLSKATPKDIAATDVMMKVLDEEAPPASEEERQLHKRVFELMSRLVTEWG------KeYAFSTGLkEEDCRCEL 86  Perkinsus marinus A...
Q4E647     6 GPTKPLEVPPAQPRDLAESKRLCETMATVVADRVRE-------AIDLIELTAHRLVDQITA-E---------PEERWVRA 68  Trypanosoma cruzi
Q7XN15    10 GVAEPISLVGPTPADLESTARLERLLREEGLYESAEETAAREEVLRGLRGVVDRWVKRLTR-Q-RGYPDGM-ADRATALV 86  rice
EMS65178  15 GVTPAGSFDGPLEADLHSTQELEQLLAELGLYKSKEETARQEEVLRKLDKIVKEWVKELAI-Q-RG------QVNTNVGL 86  Triticum urartu
CBI27991  12 GLTKPISYVKPTDFHIRRSFELEKVLWDGGVYQVEEEARKREEIIEKLRVVVKSWVKQVTR-W-KGYTDKM-VENANALI 88  wine grape
EDQ82924   8 GVTEPISTADPTEVDYVNTKQLEECVKGLALQGSREEEVRREEVLGRLDELVNVWVKSMSR-K-KGLNDEY-VREARCKI 84  Physcomitrella patens
1Q78_A    98 FTFGSYRLGVHTKGADIDALCVAPRHVDR-SDFFTSFYDKLKLQEEVKD--LRAVEEAFVPVIKLCFDGIEIDILFARLA 174 cattle
EEA06148 102 YTFGSYRLGVVAAGSDIDTLCIVPRHITR-DSFFTFFLAKLQQDIHITK--IQPVPDAYTPIIKMVYYGIEMDLLFACLN 178 Cryptosporidium mur...
EDO05187  92 LTFGSYRLGIVAPNSDIDCLCLCPQSVTR-ESFFTDFYNALKLLPNITK--LHAVPDAYTPVIKLIYDGIDIDLLFANLP 168 Babesia bovis
Q4N9S7    92 LTFGSYRLGIVAPDSDIDVLCLCPRSVTR-ESFFSDFYNTLNKVDGISK--LQAVPDAYTPVIKLYFYDISIDILFANLD 168 Theileria parva
EER05794  87 MAIGSARLGLQDPSSDIDCVVVAAHKVTR-DAFFELFPLKLSELNDVTN--LNPVPQAAVPVIKMKFMGVDVDVLYCGLA 163 Perkinsus marinus A...
Q4E647    69 YPFGSCGLGASVADSDLDIVLFCSFKVTA-EVFFREFPPLLQP--VVGNvvLVP---ARVPVVKFSYSGTSVDVVFVSAA 142 Trypanosoma cruzi
Q7XN15    87 LPFGSYRLGVHGRGSDIDALVVGPSYVDCdRDFFGALATALAETAAVAE--LQPVPGAHVPVIKMRFHGVQVDLVYAGVC 164 rice
EMS65178  87 FTFGSYHLGVDEPGADIDTLCVGPKYVNC-------------------E--LH---------------GISINLLYANVS 130 Triticum urartu
CBI27991  89 VTFGSYRLGVHGPGSDIDTLCIGPSYVNReEDFFIRLHNILIGMEGVSE--LLPIPHAHVPVMKFKFEGVSIDLLYASVS 166 wine grape
EDQ82924  85 FTFGSYRLGVHGPGADIDTLCVGPCYVTReEDFFVELHDLLQKTEGVTE--LHTVPDAHVPVMSFEFNGIPIDLLYARLP 162 Physcomitrella patens
1Q78_A   175 LQTIPEDLDLRDDSLLKNLDIRXIRSLNGCRVTDEILHLVPNID-NFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLV 253 cattle
EEA06148 179 LSRIPSDLNTLDDDLLRNVDEKTARSLNGCRVNDMILQLVPNKE-SFRTALRFVKHWSKSRGIYSNVLGYLGGISWAILT 257 Cryptosporidium mur...
EDO05187 169 AQTVPEEIDVLDDAILRNMNEATARSINGCRVAALILASVPNKD-NFRTTLRYVKLWANRRGLYTTVMAYMGGVAWAILT 247 Babesia bovis
Q4N9S7   169 APTVSPHINVLDDNILRNMNDSTVRSINGCRVASYILDSVPNKN-YFRTTLRFIKLWASRRKIYSTVVGYLGGVAWAILT 247 Theileria parva
EER05794 164 HPLSGPAIDPADDNLLCGMDEKSARSINGVRVSDAIKACVPHFA-HFLGALRVIRAWARRRGIYSNALGYLGGVSWAILV 242 Perkinsus marinus A...
Q4E647   143 LAAPPTTEQLLDDSFLLQVARDTRHSVNGLRTVLEVKRRLPVAYdVFTTVLKSVKLWAMRRKVYGNLYCYPSGVVLAIMV 222 Trypanosoma cruzi
Q7XN15   165 LPVVPGDLDLSGRSVLRGLDLATARSLNGVRVADEILRLVPDAT-AFRTTLRCVKHWAKARGVYSNVAGFLGGVGWAILV 243 rice
EMS65178 131 LAVVPSDLDISQNSVLSGVDEVNLRSLSECRVADQILDLVPNIE-NFRTTLRCVKHWAKRRGVCVNAPGYLREVDCPVMV 209 Triticum urartu
CBI27991 167 HLVVPDDLDISNESILYEADEPTVRSLSGCRVADQILRLVPNVE-HFRTTLRCLKFWAKRRGVYSNVTGFLGGVNLALLV 245 wine grape
EDQ82924 163 LWVIPEELDILQDTILQNVDEQSVRSLNGCRVTDRILRLVPNME-HFRTTLRYVKLWAKRRGVYSNVIGFLGGVNWALLV 241 Physcomitrella patens
1Q78_A   254 ARTCQLYPNAIASTLVHKFFLVFSKWEW---PN-P--VLLKQPEEc--N-L-NLP--VWDP--RVNPSD-----RYHLMP 314 cattle
EEA06148 258 ARICQLYPNSAPNQIINRFFYVYKAWQW---KN-P--VILCEIKEvpkNsPgLMGfrVWNP--NTNPQD-----RAHLMP 324 Cryptosporidium mur...
EDO05187 248 ARVCQLYPNFLPNQLIQKFFRVYAQWNW---KC-P--VMLCKIKEv-pNiPgYMSfkVWDP--RNNPTD-----RQHLMP 313 Babesia bovis
Q4N9S7   248 ARVCQLYPNCAPNQLIEKFFRVYSVWQW---EC-P--VTLCKIKEp-pNiPgLMSfkVWDP--RVNPQD-----RHHLMP 313 Theileria parva
EER05794 243 ARVCQLFPNMGPSQLVVRFFRVYSRWNWd--PS-EgaVVLRHSEQrngEgF--QHhkVWCPppKRTTTDqplplAASPMA 317 Perkinsus marinus A...
Q4E647   223 ARICQVMPASHPNVLLRFFFLFYTQWLSrhdRIsP--VYITTSLEsrgRiP--GLpdSWDP---RRDAC-----RDDLLP 290 Trypanosoma cruzi
Q7XN15   244 ACVCLLYPNASPSMLLPRFFRVFARWKW---PS-P--VMLRAIEHddgElG--LSlpVWDP--RRNPRD-----KIHLMP 308 rice
EMS65178 210 ACICLAYPNAAPSTLVTMLFSIFGEWYW---PN-P--VMLCSIHEd-rE----LGfpVWDA--RFNRED-----RTHIMP 271 Triticum urartu
CBI27991 246 ARVCQLYPNANPSMLVSRFFRVYTQWHW---PN-P--VMLCPIEDk------eLGfpVWDP--RRNPLD-----RNHHMP 306 wine grape
EDQ82924 242 ARICQLYPNAVPSVLLSRFFRVYKQWRW---PN-P--VMLCAIEEg------pLGlpVWDP--RRNPRD-----RSHLMP 302 Physcomitrella patens
1Q78_A   315 IITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAIT------DEILLSKA--E-WSKLFE 363 cattle
EEA06148 325 IITPAFPSMNSTHNVTQTTLRVITEELQRGSELV------KEIENERA--Q-WSDLWS 373 Cryptosporidium muris RN66
EDO05187 314 VITPAFPSMNSTHNITLTTKRILTDEFKRANDLLkvnakgAQMKNI------WERVLE 365 Babesia bovis
Q4N9S7   314 IITPAFPSMNSTHNVTATTKRVITEELMRALEIFk----tSNLTNVEL----WEKVLE 363 Theileria parva
EER05794 318 VITPAYPSMNSTFGVTRMTMDTIKKELERGAGIIss--kgVDLRSREC----WETLLE 369 Perkinsus marinus ATCC 50983
Q4E647   291 VINPAYPYVNDARNVGRCSLEVFYAELTYAYRLL------SNLET-P-----LEAIWE 336 Trypanosoma cruzi
Q7XN15   309 IVTPAYPCMNSGYNVSHATLRVITEQLAVGDAVC------QEIVKAGSggGgWDKLFQ 360 rice
EMS65178 272 IITPAYPCRNSTVHVSATTLEVMKEQFQIGNEVC------QEIEMKQA--D-WADLFE 320 Triticum urartu
CBI27991 307 IITPAYPNMNSSYSVSTSTLEAMMKQFHTANKIC------NDIELNKS--S-WGALFE 355 wine grape
EDQ82924 303 IITPTYPCQNSSFNVSNSTLRVMTEEFKRGDSIC------DSLDSKVA--D-WSKLFE 351 Physcomitrella patens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap