Conserved Protein Domain Family
Tenui_NCP

?
pfam04876: Tenui_NCP 
Tenuivirus major non-capsid protein
This protein of unknown function accumulates in large amounts in tenuivirus infected cells. It is found in all forms of the inclusion bodies that are formed after infection.
Statistics
?
PSSM-Id: 282700
View PSSM: pfam04876
Aligned: 2 rows
Threshold Bit Score: 368.232
Threshold Setting Gi: 267255
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 267255   5 QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFC 84
gi 267255   5 QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFC 84
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 267255  85 HSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMP 164
gi 267255  85 HSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMP 164
                     170
              ....*....|...
gi 267255 165 TYFESIIQPLLHK 177
gi 267255 165 TYFESIIQPLLHK 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap