Conserved Protein Domain Family
Tenui_NCP

?
pfam04876: Tenui_NCP 
Tenuivirus major non-capsid protein
This protein of unknown function accumulates in large amounts in tenuivirus infected cells. It is found in all forms of the inclusion bodies that are formed after infection.
Statistics
?
PSSM-Id: 282700
View PSSM: pfam04876
Aligned: 2 rows
Threshold Bit Score: 368.232
Threshold Setting Gi: 267255
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q00844   5 QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFC 84  Rice stripe virus (is...
Q00844   5 QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFC 84  Rice stripe virus (is...
Q00844  85 HSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMP 164 Rice stripe virus (is...
Q00844  85 HSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMP 164 Rice stripe virus (is...
Q00844 165 TYFESIIQPLLHK 177 Rice stripe virus (isolate T)
Q00844 165 TYFESIIQPLLHK 177 Rice stripe virus (isolate T)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap