Conserved Protein Domain Family
Fzo_mitofusin

?
pfam04799: Fzo_mitofusin 
fzo-like conserved region
Family of putative transmembrane GTPase. The fzo protein is a mediator of mitochondrial fusion. This conserved region is also found in the human mitofusin protein.
Statistics
?
PSSM-Id: 309784
View PSSM: pfam04799
Aligned: 29 rows
Threshold Bit Score: 187.453
Threshold Setting Gi: 47605567
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O18412       561 NGNHwQMLESL------VKSKGSLGtVLLSAMAIRSFNWPIVLILGGLVGSFYIYEYAAWTTAAQERSFKSQYARLLQQR 634 fruit fly
XP_002432275 590 MSSN-DWSLISrmamasVSSQGTMGvLLLTGFMMRTVGWKVILVTGALYGCVYFYERLTWTNKAKEKTFKKQYVNHATKK 668 human body louse
XP_009027995 575 sdDN-ELMVSLlsafssLYSGTTIGvLAIAALLGKAAGWRVIGLCGGIYGLLYLYERITWTNSAKEKAFKRQYVDYASGK 653 Helobdella robusta
XP_003243734 594 AVEQ-NLSMISrvvaasVGTQGTVGgLVLAGFMLKTVGWRLIVAAGAVYGVLYLYERLSWTTKAKEREFKRQYVDHATAK 672 pea aphid
XP_014287762 617 lrPE-DWTLASkfalasVGSQGTVGgLLLAGMVLKTVGWRVIAVTTALYGCLYLYERLTWTNKAKEKEFKRQYVEHATKK 695 brown marmorate...
EHJ63461     576 lSAE-EWGMVSkfalgaLTSQGTMGgLLLSGLLLKTVGWRVVALTGVIYGALYAYERLTWTTSAQQRLFKRQYVSHATRK 654 monarch butterfly
XP_001893293 609 ESQEnAMMAQLilssigYVANGSLGlLVIGGIVSKAISWRFIAAGIALYGGLYAAEYWRWNSGAKEQHLKDQFRHHLNAR 688 Brugia malayi
CCD58539     510 ilprssLTVDLfp---sLMSRSAVGtVIVFGIMSKAVGWRVLAVACGIYGGLYLYERLSWTNKAKEAAFKRQYVDFASHK 586 Schistosoma man...
XP_004365821 716 TAEA-ALTLADrvglvlSTPSSYAVvTILATLVTRPGVWKLAALSGAAFGSLYLYEYALYTNGAKERRFKEQFTRHAASE 794 Capsaspora owcz...
ERG82081     615 veEN-AVIAQVvltsasYIANGGLGlIVIGGLVYRTLGWRVIAAGALAYGGLYALERWRWNSGAKEQHLKDQFRSHLATR 693 pig roundworm
O18412       635 LRSDVQQTVSGFELQLRQHLATVRNCWEAQSNETLNDLNVRTAELTKQIQSMEVLQLSLKKFRDKGQLLASRLGDFQETY 714 fruit fly
XP_002432275 669 LRMIVDLTSANCSHQVQQELSSTFARLCHLVDESTTEMTKQIKDLDKELKELDEAGNRAKVLRNKANYVLNELDIFEEKF 748 human body louse
XP_009027995 654 LRLIVDLTSANCSHQVQQELNSTFGRLCQQVEMTKNDLEDELKNLEVEITKLDEASKQAICLKNKTQFVDTELSNFMLQY 733 Helobdella robusta
XP_003243734 673 LRLIVDLTSANCSHQVQQELSTTFARLCQLVDESATNLNDEMKNLDRELNMLTKSTEIAKILRNKADLLKVELKQFDDTF 752 pea aphid
XP_014287762 696 LKLIVDLTSANCSHQVQQELSSTFARLCHLVDEATTEMGTDMKALEKELLRLEEAANSAKVLRNKASYLIKELDMFDEVY 775 brown marmorate...
EHJ63461     655 LRLIVDLTSANCSHQVQQELSTMFARLCRLVDEATTEMDEELKEVKEAIKMLEDASTSAKKLRNKANYLSHELDLFEDAF 734 monarch butterfly
XP_001893293 689 MRSVATTHTLHCETQVLREMQQVLGGLKSTVGGVHQEMKTELDNMRREIEKIDHVTKGLNTIKGKASFLNTDLDRFENEF 768 Brugia malayi
CCD58539     587 LRLIVDLTSTNARHQAKRELHLAHKKLSTEVENFSDTLVEEVKQLDSDINRLDFITTEARKLKNRANNLGNVLNKFHETF 666 Schistosoma man...
XP_004365821 795 LRRSVRQTSHTVSISLQSRLSFYVDELRNAVRQTEATLTAEIARAEREVAMMQDAISKAGLLHHEALSIRKGLADAQETF 874 Capsaspora owcz...
ERG82081     694 MRSVAAAHTAHCESQVVREMEQVYGGLKATVGGVHQEMKSELDAAHQKIGKIEGIIKGLNTIKGKTAFLNTDLDRFESEF 773 pig roundworm
O18412       715 LT 716 fruit fly
XP_002432275 749 LK 750 human body louse
XP_009027995 734 LK 735 Helobdella robusta
XP_003243734 753 Lc 754 pea aphid
XP_014287762 776 LR 777 brown marmorated stink bug
EHJ63461     735 LK 736 monarch butterfly
XP_001893293 769 LK 770 Brugia malayi
CCD58539     667 IL 668 Schistosoma mansoni
XP_004365821 875 ID 876 Capsaspora owczarzaki ATCC 30864
ERG82081     774 LK 775 pig roundworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap