Conserved Protein Domain Family
Fzo_mitofusin

?
pfam04799: Fzo_mitofusin 
fzo-like conserved region
Family of putative transmembrane GTPase. The fzo protein is a mediator of mitochondrial fusion. This conserved region is also found in the human mitofusin protein.
Statistics
?
Aligned: 30 rows
Threshold Bit Score: 186.296
Threshold Setting Gi: 47605567
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004365821        715 VTAEaALTLADRVGLVLSTPSSYAVVTILATLVTRPGVWKLAALSGAAFGSLYLYEYALYTNGAKERRFKEQFTRHAASE 794 Capsaspo...
EEB19537            590 MSSN-DWSLISRMAMASVSSQGTMGVLLLTGFMMRTVGWKVILVTGALYGCVYFYERLTWTNKAKEKTFKKQYVNHATKK 668 human bo...
XP_016658984        600 AVEQ-NLSMISRVVAASVGTQGTVGGLVLAGFMLKTVGWRLIVAAGAVYGVLYLYERLSWTTKAKEREFKRQYVDHATAK 678 pea aphid
Q7PY95              616 ITNE-QLSVISKVAIASIGSQGTLG-LVVAGLMLKTIGWRVIVGAGVIYGSVYLYERLSWTNTAKERNFKNQYVDHATRK 693 Anophele...
WGS:AAPU:GI15189-PA 644 ITPE-QLSVISRFALSSIGSQGTVGGLVVAGIMLKTIGWRVLVGIGALYGCIYLYERLSWTNSAKERAFKSQYVRHATKK 722 Drosophi...
CRZ23693            609 ESQEnAMMAQLILSSIGYVANGSLGLLVIGGIVSKAISWRFIAAGIALYGGLYAAEYWRWNSGAKEQHLKDQFRHHLNAR 688 Brugia m...
XP_018644900        510 ILPRsSLTVDL---FPSLMSRSAVGTVIVFGIMSKAVGWRVLAVACGIYGGLYLYERLSWTNKAKEAAFKRQYVDFASHK 586 Schistos...
ESN93802            574 qsDDnELMVSLLSAFSSLYSGTTIGVLAIAALLGKAAGWRVIGLCGGIYGLLYLYERITWTNSAKEKAFKRQYVDYASGK 653 Helobdel...
XP_014287762        617 lrPE-DWTLASKFALASVGSQGTVGGLLLAGMVLKTVGWRVIAVTTALYGCLYLYERLTWTNKAKEKEFKRQYVEHATKK 695 brown ma...
NP_495161           607 seEQ-AMMTQMVLTSAAFLANGSLGVLVVGGIVYKAVGWRVIAVGGAAYAGLYAWERMRWNSGAKEQHLKEQFRSHLAAR 685 Caenorha...
XP_004365821        795 LRRSVRQTSHTVSISLQSRLSFYVDELRNAVRQTEATLTAEIARAEREVAMMQDAISKAGLLHHEALSIRKGLADAQETF 874 Capsaspo...
EEB19537            669 LRMIVDLTSANCSHQVQQELSSTFARLCHLVDESTTEMTKQIKDLDKELKELDEAGNRAKVLRNKANYVLNELDIFEEKF 748 human bo...
XP_016658984        679 LRLIVDLTSANCSHQVQQELSTTFARLCQLVDESATNLNDEMKNLDRELNMLTKSTEIAKILRNKADLLKVELKQFDDTF 758 pea aphid
Q7PY95              694 LKLIVDLTSANCSHQVQQELSSTFARLCRVVDTASTEMNEELKQIESSLGVIETNQKQIKLLKNKANYIMNELEIFDSNY 773 Anophele...
WGS:AAPU:GI15189-PA 723 LKMIVDLTSANCSHQVQQELSSTFARLCRTVDTATTDMNEELKTLEAQLNVLESNQKQLKLLRNKANYIQNELDIFEHNY 802 Drosophi...
CRZ23693            689 MRSVATTHTLHCETQVLREMQQVLGGLKSTVGGVHQEMKTELDNMRREIEKIDHVTKGLNTIKGKASFLNTDLDRFENEF 768 Brugia m...
XP_018644900        587 LRLIVDLTSTNARHQAKRELHLAHKKLSTEVENFSDTLVEEVKQLDSDINRLDFITTEARKLKNRANNLGNVLNKFHETF 666 Schistos...
ESN93802            654 LRLIVDLTSANCSHQVQQELNSTFGRLCQQVEMTKNDLEDELKNLEVEITKLDEASKQAICLKNKTQFVDTELSNFMLQY 733 Helobdel...
XP_014287762        696 LKLIVDLTSANCSHQVQQELSSTFARLCHLVDEATTEMGTDMKALEKELLRLEEAANSAKVLRNKASYLIKELDMFDEVY 775 brown ma...
NP_495161           686 MQQVSTAHTHHCETQAIREMDQVFDGLKATVGGVHREMKNDLDVQKTQIDAVDSTIRTLGTIKGKAVFLLRNLEQFASSY 765 Caenorha...
XP_004365821        875 ID 876 Capsaspora owczarzaki ATCC 30864
EEB19537            749 LK 750 human body louse
XP_016658984        759 Lc 760 pea aphid
Q7PY95              774 IK 775 Anopheles gambiae str. PEST
WGS:AAPU:GI15189-PA 803 IA 804 Drosophila mojavensis
CRZ23693            769 LK 770 Brugia malayi
XP_018644900        667 IL 668 Schistosoma mansoni
ESN93802            734 LK 735 Helobdella robusta
XP_014287762        776 LR 777 brown marmorated stink bug
NP_495161           766 LR 767 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap