Conserved Protein Domain Family
IKI3

?
pfam04762: IKI3 
IKI3 family
Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation. This region contains WD40 like repeats.
Statistics
?
PSSM-Id: 309758
View PSSM: pfam04762
Aligned: 25 rows
Threshold Bit Score: 866.209
Threshold Setting Gi: 145355288
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9FNA4          1 MKNLKLFSEVPQNIQLHSTe-------EVVQFAAYDIDQSRLFFASSANFV-YALQLSSFQNESagak-samPVeVCSID 71   thale cress
O59704          1 MKNLVTHLHHVFPNVNG-----------SIKALAFNSISDKIYVVCGLDNEnPGIEIYEISEND---------DvSKLVE 60   Schizosacchar...
Q9VGK7          1 MRNLKLRYCKELNAVAHPQh-------LLLQPEL-NGGASDIYFVVADNKI-Y---AVQESGDV--------RL-KVIAD 59   fruit fly
Q17MG4          1 MKNLYRIALQSARFDGIPSsp-----dRQNLMVVDSNNSNLVYIVVGSVLY----RLDRTNPHCv----------QELVS 61   yellow fever ...
Q54Q66          1 MKNITRLSEFNDLIVDGNGdfkl-fsiDQQSNVVYFITENNQLIIYSPSTKkVSMRIELDEQDIlse------------- 66   Dictyostelium...
Q8WND5          1 MRNLKLLQTLEFKDIQAPGkpqc-fslRTEPGTV-LIGSEHGLIEVDPVTReVKNEIPLVAEGFlpe------------- 65   rabbit
XP_001629314    1 MKNLELLRCVPVTELGSFSsppscltvDCDTGII-YTASTVEIIGLQPESQeVVVTSSLATNDYfpd------------- 66   starlet sea a...
XP_318429       1 MRNLYRVSHSRFDLSENALr------sVRSGFAIDQNTDHKFYFVQDSGVYcCPLFVDREHPFC---------------- 58   Anopheles gam...
XP_001359305    1 MRNLKLQFCNELQTKVPQPr------qMLQGPEVRLEGTETTYIVTDSNVY--AVKGTGSPPAK------------VIAD 60   Drosophila ps...
XP_011387076    1 MRNLSVLSHRAITFASGSP--------LKIKATAADLDNGSIYAVATSRISpTAADVTIHFLKVssqeqaftQFnSLLVP 72   Ustilago mayd...
Q9FNA4         72 IEPG-----------------DFITAFDYLAE-------KESLLIGTSHGLLLVH----------NVESDVTELVGNIEG 117  thale cress
O59704         61 FDSPsfvsd--------ngdiDEIQSMQFLGE-------PMAICLSLKGGDIVMVkv------dpSPEEAPWEIIGNVEN 119  Schizosacchar...
Q9VGK7         60 LP--------------------DIVGVEFLQL-------DNAICVASGAGEVILV----------DPQTGATSEGTFCDV 102  fruit fly
Q17MG4         62 LP-------------------GTVVGVEHLAL-------NDEICLATEAGEVLVVn--------lGRIGEEPEVVTFCGG 107  yellow fever ...
Q54Q66         67 --------------------gakVISIQFIPD-------LDAVCMASNKGDILMY----------STSNGELECVGIIGS 109  Dictyostelium...
Q8WND5         66 ------------------dksGCIVGIQDLLD-------QESVCIATASGDVILC----------NLSTHQLECVGSVAS 110  rabbit
XP_001629314   67 ------------------nnsN-VIGIQHLPD-------LESVCVCMGSGDVLLY----------NTLTQQTECVGSTDS 110  starlet sea a...
XP_318429      59 --EPllsq---------sdgyENIIALEHLAL-------SDELCCASSSGNVWSC----------KLETGVVEEVTHCKH 110  Anopheles gam...
XP_001359305   61 LP--------------------DIVAAEFLQL-------NNVICVATRAGEVLLI----------DPDTLATSEGTYCDV 103  Drosophila ps...
XP_011387076   73 GPPSplpnsstavastsgrspTDVIDFHYLSDggqevqnQAALCTISAGGDLLLLpvssanetldDAPAIEPSVVGTIEQ 152  Ustilago mayd...
Q9FNA4        118 GVKCISPNPTGDLLGLITGL-------------GQLLVM-TYDWALMYEKALGevPEGgYVreTNDLSvnc--------- 174  thale cress
O59704        120 GIVASCWSTDEQVFCIITGG-------------DTILFM-TKNFDIISETSLS--DADlNEf-NKHISvgwgrsetqfrg 182  Schizosacchar...
Q9VGK7        103 GIESMAWSPNQEVVAFVTRT-------------HNVVLM-TSTFDVIAEQPLD--AELdPD--QQFVNvgwgkketqfhg 164  fruit fly
Q17MG4        108 GMMAMGWSPDQEVVVFVDCN-------------LNVVAM-NSAYDPINEVSLK--DDTfGD--REFMSvgwgkketqfhg 169  yellow fever ...
Q54Q66        110 GITCMSWSPDYELFILATES-------------ETLIQM-TKDWEMINEVSIN--SYLpGK--PKTATtttnnnns---- 167  Dictyostelium...
Q8WND5        111 GISVMSWSPDQELVLLATGQ-------------QTLIMM-TKDFEPIMEQQIH--QDDfGE--SKFITvgwgkketqfhg 172  rabbit
XP_001629314  111 GISCMAWSPDLELVVFTTGE-------------NTVIMM-TKDFDPITEFPIH--TAEfGQ--DEPINvgwgkketqfhg 172  starlet sea a...
XP_318429     111 GIRAMQWSPDQELVVFVDGE-------------LNVVTMiGSEFEPINEVQLK--DDTfGD--RQFMSvgwgkketqfhg 173  Anopheles gam...
XP_001359305  104 GIERMAWSPSQEVVAFITTS-------------HNVVVM-NSTFDVIAEQPLE--AELpAD--QQFINvgwgkketqfhg 165  Drosophila ps...
XP_011387076  153 GIGAACWSPDDELLVLVTSEmpqdasstgrseaEKVLLM-TRDFEVLSELSLR--TDSfGE--DEAVDvgwgskatqfhg 227  Ustilago mayd...
Q9FNA4        175 ---------------------------------ggiSISWRGDGKYFATMGEvyESGc---------MSKKIKIWESDsG 212  thale cress
O59704        183 krvraklrd-------ptlpekidegklsdvddgktYICWRGDSQYVSINRL--EKG----------PRRAIRVYSRE-G 242  Schizosacchar...
Q9VGK7        165 segkqaak---------qkesdstfirdeqelnqdvSISWRGDGEFFVVSYVaaQLG------------RTFKVYDSE-G 222  fruit fly
Q17MG4        170 segksaar---------kkkeeteveidlskidpqvQISWRADGEYFAVGFLgpFG-------------RAFKVFNKE-G 226  yellow fever ...
Q54Q66        168 -----------------------------kninkipIITWRGDGQYFACSSYeeDIG-----------KIQLRIWERS-L 206  Dictyostelium...
Q8WND5        173 segrqa------------afqiqthesalpwddhrpRVTWRGDGQFFAVSVVcpETG-----------ARKVRVWNRE-F 228  rabbit
XP_001629314  173 sagkpst-----------etlkptvtpsfpwddhhcRISWRGDGQYFVVSAIepATD-----------ARKLRVWSRE-G 229  starlet sea a...
XP_318429     174 segkaaakk-------gttpsepstaeterqldatvNISWRADGEYFAVGYLapFGQ------------RAFKVFNKE-G 233  Anopheles gam...
XP_001359305  166 sagkqaa----------kqstdqtaqmtqellsqdvNIAWRGDGAYFVVSY---ESG----------GGRTFKVYDNE-G 221  Drosophila ps...
XP_011387076  228 segkaaaaaaaeaaaaakesktdtrgpklpdddgrpRISWRGDGAFFAISSLepFIPsssdsatdliWHRIIRIYSRT-G 306  Ustilago mayd...
Q9FNA4        213 ALQSSSE-TKEFTQGILEWMPSGAKIAAVYkrKsdDSS------------PSIAFFERNGLERSSFRIGEpeDATESC-- 277  thale cress
O59704        243 LLDSISE-PQDGQQSLLSWKPSGSVLATIKsdSs-DNS------------SKVIFFERNGLRHGEFSLRR--REDEKY-- 304  Schizosacchar...
Q9VGK7        223 KLNHTAE-KSANLKDSVVWRPTGNWIAVPQ--Qf-PNK------------STIALFEKNGLRHRELVLPFd-LQEEPV-- 283  fruit fly
Q17MG4        227 ALQFTSE-KCYGLEVPMGWKPSGLWIAVPQ--Il-KDK------------YVVALFEKNGLKHREIDLPFs-HEDELV-- 287  yellow fever ...
Q54Q66        207 QLHSMNEsDVTGLENQISWRPNGSMIAVSQ--RleQTR------------HDISFFERNGLKHGEFTL----RSKGEI-- 266  Dictyostelium...
Q8WND5        229 ALQSTSE-PVPGLGPALAWKPSGSLIASTQ--Nk-PNQ------------QDVVFFEKNGLLHGQFTLPFl-KDEVKV-- 289  rabbit
XP_001629314  230 VLMTSSE-EVDGLEQSLCWKPSGSLIASTQ--Rk-PHR------------HDVVFFERNGLRHGEFTLPFq-RMEVKV-- 290  starlet sea a...
XP_318429     234 ALQYTSE-KCHGLEGSLAWRPSGNWIAIPQ--El-KDR------------YVVALFEKNGLRHREIPLTLnpRAGQSV-- 295  Anopheles gam...
XP_001359305  222 KLQHTAE-KSSNLREIIAWRPSGNWIALPQ--Wf-PNK------------STISLFEKNGLRHRELVLPFd-LQEEPI-- 282  Drosophila ps...
XP_011387076  307 ALSATSDaSVRGISQTLAFRPIGNLIASTQrfGp-SDVqgqmwsqgrkgrHDVVFFERNGLRHGEFSLREe-SASQPQgt 384  Ustilago mayd...
Q9FNA4        278 -------------------ENLKWNSASDLLAGvvSCk-------tYDA-------------IRVWFFSNNHWYLKQEIR 318  thale cress
O59704        305 -------------------TGLAWNVSSSILAV--ST---------ENS-------------VMLWTTGNYHWYLKKEIN 341  Schizosacchar...
Q9VGK7        284 -------------------VQLRWSEDSDILAI--RTca-----keEQR-------------VYLYTIGNYHWYLKQVLI 324  fruit fly
Q17MG4        288 -------------------KGIYWSHDSEVLVIrtQK---------LSRgk---------ncLYFLIICNYHWYIKQYQE 330  yellow fever ...
Q54Q66        267 -------------------QSIQWSSDSEILGIqlYL---------EDEkr---------svLQLWHRSNYYWFLKQEIQ 309  Dictyostelium...
Q8WND5        290 -------------------NDLLWNADSSVLAV--WL---------EDLqreeds--vlktyVQLWTVGNYHWYLNECLP 337  rabbit
XP_001629314  291 -------------------IEMQWSTDSTVLAI--RI---------EEMlpedrqnaiprsyIQLWTVNNYHWYLKQELA 340  starlet sea a...
XP_318429     296 -------------------QSLHWSADSDVLAVhwVD---------GEQgt---------tgVLLYVIGNYHWYLKQSLT 338  Anopheles gam...
XP_001359305  283 -------------------LQLKWSEDSDILAI--RTake---keqQQR-------------VYLYTIGNYHWYLKQVLV 325  Drosophila ps...
XP_011387076  385 qlgwidsqneapwsrthfvRELAWNADGSALAV--WLtrageansaHDV-------------VQIYTTGNYHWYLKQEFV 449  Ustilago mayd...
Q9FNA4        319 YPREAGVT-------VMWDPT--KPLQLICWTLs-GQVSVRHFMWVTAVMEDSt------AFVIDNSKILVTPLSLSLMP 382  thale cress
O59704        342 IPQNAL---------ISWHPE--HANTLYITGK--NHIEKVVFDLKYVTEFSTspndfglIPVIDGSSLLVTPLSLCNIP 408  Schizosacchar...
Q9VGK7        325 FEQADPLAl------LHWDTRcgAEHTLHVLKEs-GKHLVYRWAFAVDRNns-------iVGVIDGKRLLLTDFDEAIVP 390  fruit fly
Q17MG4        331 FEQDIIG--------IQWDLKysERRTLHVLLKd-GHYEASRWDFSVDHSTGLehtdeslVAVIDRASVLLTNFRGVVIP 401  yellow fever ...
Q54Q66        310 CGDSNNNNtnerivnIQWDLS--SPI-VRVLTQi-GRFSEYRLCWDYDVSQGSsennpttVVMVDGNQLKLTPFRRLVVP 385  Dictyostelium...
Q8WND5        338 FSTYGKSKiv----sLMWDPV--IPYRLHVLCQg-WHYLCYDWRWTTDRSSGDnesdlanVAVIDGNRILVTVFQQTVVP 410  rabbit
XP_001629314  341 FPASASDRva----cFSWDPE--NALKLHLITGg-GQYASYEWTWSTLHSQSHsthnistVAVIDGANLLLTPMKYMVVP 413  starlet sea a...
XP_318429     339 YPPGTALTg------LQWDQRhtAGKTLHLFSSdpGVYECIRFDFRVDRSVGLseedqtmVAVIDGKRLLLTGFRQAVIP 412  Anopheles gam...
XP_001359305  326 YADTDPVAv------VHWDTRmgAEQTLHVLLEs-GKQLAYCWAFEVEpyar-----hgiVGVIDGKRLLLTDFARAVVP 393  Drosophila ps...
XP_011387076  450 TSVMQGVEq------VNWHPE--DPLQLLIAHT--DRVEQRYFTLETMASGGRppvdvacVAVADGAATLLTPFRMQNVP 519  Ustilago mayd...
Q9FNA4        383 PPMYLFSLSFS----------SAVRDIAYYSRNSKn----------cLAVFLSDGNLSFVEf------------------ 424  thale cress
O59704        409 PPMCRYKLSLD----------YNVQMTSINATSD-------------MLFAADDRRLTAFTf------------------ 447  Schizosacchar...
Q9VGK7        391 PPMSKIVLKFE----------TYINAFISHGTS--------------LWVYTCDRKIYLNEh------------------ 428  fruit fly
Q17MG4        402 PPMCGFSVKVE----------DLINSISFLRNPQDqmd------sncFLTVDFHNKVSFFK------------------- 446  yellow fever ...
Q54Q66        386 PPMSAYSIELP----------DRLNCLGFSFNQSTy-----------QLSVMVDQSILIYTpatlpptpkatlpkiksan 444  Dictyostelium...
Q8WND5        411 PPMCTYRLLLP----------HPVNQVTFCALPKKsn---------dLAVLDASNQISVYKcgdspsmdptvkl------ 465  rabbit
XP_001629314  414 PPMAAQTVAMP----------AAIQSVTFAPPPACn----------dMAVLLSSGDIAILRmpsapae------------ 461  starlet sea a...
XP_318429     413 PPMCGFTLEQE----------HPINATGFIRTAGRcealgqdissnaFFTVDCRGEIILYDavftkt------------- 469  Anopheles gam...
XP_001359305  394 PPMSQRVLQLD----------EYINAIAWDDQQ--------------VCVYTCDRRFYFYElkdr--------------- 434  Drosophila ps...
XP_011387076  520 PPMASLSLLLPpadpsmrasaAAAVTVPCHTAWSQlpgrsldeaigiMAAVFQNGFIQIWRfdwgllgsh---------- 589  Ustilago mayd...
Q9FNA4        425 -------------------PAPNTWEDlegkdfSVEISDCKTALGSFVHLLWLDVH----SLLCVSAYgsshnkclssgg 481  thale cress
O59704        448 ------------------nSQEDIAKFgefdisTYAEGLN------FKSLLGLSGN----QVLLLADGt----------- 488  Schizosacchar...
Q9VGK7        429 -------------------IHTLGKELqk---pIMLMPDAELSGLHLANLTHFSPH----YLLATHSSa----------- 471  fruit fly
Q17MG4        447 -------------------PDFTDTAVrrltgvQLLGKALDIGPGNYSHWLWLSND----TLLAVEG------------- 490  yellow fever ...
Q54Q66        445 gllaplpsdfkanlpnysiAPTLTSRVvi--------dRSKLQLHKIRHFLWLNAS----TFIGVESKtnq--------- 503  Dictyostelium...
Q8WND5        466 ------gavggngfkvslrTPHLEKRYki---qFESNEDQETNPLKLSLLSWIEED----IFLAICHSqcs--------- 523  rabbit
XP_001629314  462 -------------fippgsPPRLQGVYsi---iDPDLPGLWRGPGALHHVTWWRDD----KLVGVVWNams--------- 512  starlet sea a...
XP_318429     470 -------------agrsilSGVTVLLKispeqlKMFNEDFPQQHHCGLHYLWLNAD----NFVMDHS------------- 519  Anopheles gam...
XP_001359305  435 ---------------lqqqPEPTSGSIkl-------pPLHGVQLLELANFTYFSRD----AQLLATTSa----------- 477  Drosophila ps...
XP_011387076  590 ----------nkvrgspaaEPKLIAAVqlnnmqSTASAAYQIAVAGWAAPSLENQEankvSLAVLSSA------------ 647  Ustilago mayd...
Q9FNA4        482 ydtelhgSYLQEVEVVCH-EDHVPdqvtcsgfKASITFQTLLESPVLALAWNPSKRd--sAFVEFE-GGKVLgyas---- 553  thale cress
O59704        489 -------NNCSKFFVFQC-DEDNE--------SLKLLASESFESCILNASYCSEM-----LFFQTS-SGKLIs------- 539  Schizosacchar...
Q9VGK7        472 --------GSTRLLLLSY-KDNDNkpg---ewFYRVHSSVRINGLVNAVAVAPYAMn--eFYVQTVnNGHTY-------- 529  fruit fly
Q17MG4        491 -------SNTLKVFKVDV-CKSEFc------vLDSFSVGTEIDRIGCIEPINESS-----AMIETF-TGQLF-------- 542  yellow fever ...
Q54Q66        504 -----nsDSIVEIVFNVSsGELEN--------IYRTSVSTKILRLTHHLQSLDQ------CLFESI-DGYLHlyn----- 558  Dictyostelium...
Q8WND5        524 ----pqqSVIHRLTVVPCeVDEEQg-------QLSVSSSISVDGIIISMCCNSKTKs---VALQLA-DGQILkyiw---- 584  rabbit
XP_001629314  513 -----qsEALCEITIKDK-GEGGT--------ELVVSHVTELDEPAMRVTSNPDTGs---LAIQLV-SGVILkyns---- 570  starlet sea a...
XP_318429     520 -------QLRCGVYTIAMhNDVPGl------kKVWHMEMENREEIGCIESSGADS-----ILVELL-SGHVMevkgltgq 580  Anopheles gam...
XP_001359305  478 -------LGITRLLWLQK-SENE---------DCHWIDSLRIDGLVNALSRATHNCr--hIYAHTLdSGKTY-------- 530  Drosophila ps...
XP_011387076  648 -------PQGAKIDLLEL-SQAQDaevlsgyaQRSVTVSAHGKKRIVADPFVPVSTtspsFYLENE-DGEVH-------- 710  Ustilago mayd...
Q9FNA4        554 rseIMETRSSDDSV-------------CFPSTCPWVRVAQVDASGVh----KPLICGL-DDMGRLSINGKNLCNNCSSFS 615  thale cress
O59704        540 --yNLNVKSIESISl------------SFPKPCSDFVVVPVHETF--------VPIGL-TSYGRLYAEQRLLSTGVLSFF 596  Schizosacchar...
Q9VGK7        530 ---EVSLKADKTLKver-------syvQLHEPADQIDWVIVKGCIWdg--yTGALVTL-RNQHLLHIDGYRIGEDVTSFC 596  fruit fly
Q17MG4        543 ---KLELQPSISLCeh----------lQLPEFCEQMRIDHSDPTK-------CKIYSL-RNRQNLYADGIKIASDVTSMF 601  yellow fever ...
Q54Q66        559 cstSASSGGNLEQPtsispfiyqenifKFPTPCPWFSSCTINQED--------SVVGL-NDRNKLYINQSLLCTDCNSFA 629  Dictyostelium...
Q8WND5        585 espSLAVEPWKNPGgf---------piQFPYPCIQTELAMIGGEE--------CVLGL-TDRCRFFINDTEVASNITSFA 646  rabbit
XP_001629314  571 dkdGARVSQWLNEIgq---------qvSLPQTCVQMRIAQIGNKE--------IILGL-TSHYRLYADDKEVATNCTSFA 632  starlet sea a...
XP_318429     581 qdgALETSSRNHS--------------VLPVFCEQLFVDRNRPER--------TVYALaQNRRHLYRDGSLLASDITSAL 638  Anopheles gam...
XP_001359305  531 ---DVSLASDNALAmeqvsa--kqfepSLESTYEMIRLFPXMFLNVxpftsLGGLVTL-RRQNLLQ-SGEPIAEDVTSFL 603  Drosophila ps...
XP_011387076  711 ---TVDKGEWHLVT-------------KLERFCSDFRILASGRAGQq---sKIKIIGL-ASNGRLLAEKQVIAKDATSFT 770  Ustilago mayd...
Q9FNA4        616 FyselaneVVTHLIILTKQDFLFIVDTKdv------------lNGDVALGNVFFVIDgr-rRDEEnmsyvNIWERGAKVI 682  thale cress
O59704        597 C-------TERFVLFTTTKNLLKFVHLVs-------------tVDDLQVVEDDAVDR----HDERc----RVVERGSKIV 648  Schizosacchar...
Q9VGK7        597 V-------VTNYLVYTQLNA-MHFVQLD------------------------DRR-------QVAs----RNIERGAKIV 633  fruit fly
Q17MG4        602 L-------TEHYLLFTTISE-LKFVDLK-----------------------------------KNvivgdRRIERGSKLV 638  yellow fever ...
Q54Q66        630 L-------HNKFLLFTTVSHVLRSVSLLappptqpltyvpvsnVIGNYVGHKSQALQqqsnYDDSi----RDVERGSRIV 698  Dictyostelium...
Q8WND5        647 V-------YDEFLLLTTHSHTCQCYCLKda------------sIKTLQAGLSSSHVS----NGEIl----RKVERGSRIV 699  rabbit
XP_001629314  633 V-------HDEFLLLSTHAHTCRCISLLp-------------sSQGLPVLLEDKPNA----LDESi----RRVERGSQIV 684  starlet sea a...
XP_318429     639 L-------TDSYLLCTTISE-LKFIALG----------------------------AavvaPGRDpiigeRRVERGSKLV 682  Anopheles gam...
XP_001359305  604 F-------IGTYLAYTQMNT-LHFVDAD------------------------NRQ-------QLAs----RNIERGAKLV 640  Drosophila ps...
XP_011387076  771 L-------VGSFLVWTNTSHEARFLPLT---------------SLGWTAAEGGRDASgseaVDLG-----RRVERGSRIV 823  Ustilago mayd...
Q9FNA4        683 GVLNGDeAAVILQTMRGNLECIYPRKLVLSSITNA--LA----QQRFKDAFNLVRRHRIDFNVIVDlYGWQAFLQSAVA- 755  thale cress
O59704        649 ASMPSK-MAVVLQMPRGNLETIYPRIMVLDGVRTY--IK----ALKYGDAFKVCRTHRLDLNILFD-YDPDLFLKNIPV- 719  Schizosacchar...
Q9VGK7        634 TAVARK-ARVVLQLPRGNLEAICPRVLVLELVGDL--LE----RGKYQKAIEMSRKQRINLNIIFD-HDVKRFVSSVGA- 704  fruit fly
Q17MG4        639 VVVPKS-ARTVFQLPRGNLEAIAPRILSLCLVADH--LN----ALEYHEAFDILRKERINLNLIVD-HNPHLFLSNLDR- 709  yellow fever ...
Q54Q66        699 AVVPHD-TRLVLQMPRGNLEAISPRSLTLATIREM--IN----NHQYLSAFLTMRRNRIDMNFIYD-HNPTDFIRHIEE- 769  Dictyostelium...
Q8WND5        700 TVVPQD-TKLILQMPRGNLEVVHHRALVLAQIRKW--LD----KIMFKEAFECMRKLRINLNLIHD-HNPEVFLQNVET- 770  rabbit
XP_001629314  685 VAVTQD-TKVILQV---SAEFNHSLPLILNPDVNYrvLS----GTIYRELY-YMESARVRILFTSSaKNERLFLANIET- 754  starlet sea a...
XP_318429     683 AVVARA-SRTIFQLPRGNLEAINPRVLSLCLIAKH--LD----ALEYYEAFDIMRKERINLNLLVD-HDPARFLQHLASh 754  Anopheles gam...
XP_001359305  641 TVIDEE-ARVVLQLPRGNLEAIYPRLLVLDHVRVL--LNaptrQDRYLEAMKLLRKNRINLNIICD-TNVAMFVDHVDD- 715  Drosophila ps...
XP_011387076  824 TAVPSA-MSLILQMPRGNLETIYPRPLVLEVVRRN--ID----AQRYGPAFRICRTHRMDVNILYD-HDPEAFMRNVAT- 894  Ustilago mayd...
Q9FNA4        756 FVEQVNNLNHVTEFVCAMKNEDVTETLYKKFS----FSKKGDEVFRVKDSCSNKVSSVLQAIRKALEehIPESPSRELCI 831  thale cress
O59704        720 FVDGLYRVDYLDLFLTSLKPENVTTGMYSDTS--------KSQSQQSVTTIDNKVNLLCKIIREHLT--SKYGDTHFQAI 789  Schizosacchar...
Q9VGK7        705 FLNDINEPQWLCLFLSELQNEDFTKGMYSSNY------DASKQTYPSDYRVDQKVEYVCRLLEQQM---NRFVSRFRLPL 775  fruit fly
Q17MG4        710 FLEEITNVNWLNLFISDLQNQDVCSDMYESNY------LGREVSAIDGYQVDSKSEFLCDRLLQAFNs-AKTGINYMLPK 782  yellow fever ...
Q54Q66        770 FVDQIQQIDYLNLFISSLRDEDTTKTLFIDLEt--kHLLPPTNVVKPSSIVVGKVNLVCDSLRKVFM--EKDSIKFNLPI 845  Dictyostelium...
Q8WND5        771 FIRQIDCVNHINLFFTELKEEDVTKTMYPPPV--------PSSVQQSRDPGGTKLDLICDALRVAME--NINPHKYCLPI 840  rabbit
XP_001629314  755 FLKQVESVAFINLFLSDLRDEDTTITMYGDFY--------PCATKRGSSSDKTKIDTVCDACREALQ--NLGKEKYLLSI 824  starlet sea a...
XP_318429     755 FLRQITNVNWLNLFISDLANQDACK-MYESNYl---DRGTGGGSLPDGYTIAEKVRFCCDRLLAAM---DSEPTVLTLPK 827  Anopheles gam...
XP_001359305  716 FLREIQEIQWLCLFISELQNEDTTA-MYPRRA------NESPQRLPRGFKFEEKVSYICALFLSRMTetAKDRTRFRLPL 788  Drosophila ps...
XP_011387076  895 FVRQVADVDYLNLFLSGLRDEDVTRTLYKPLSsqtsASDPSPLSATATATTQSKVNKVCDAIRVELE--ELDSRKYVQSI 972  Ustilago mayd...
Q9FNA4        832 LTTLARSDPPAIEESLLRIKSVREMellnssddirkkSCPSAEEALKHLLWLLDSEAVFEAALGLYDLNLAAIVALNSQR 911  thale cress
O59704        790 ITSYLCESPPKIEAALGMISGLIKA------------QSETVDLAIEHMCFLVDVNMLFDHALGLYDLKLALLIAQQSQK 857  Schizosacchar...
Q9VGK7        776 ITAYVKLG--CLEMALQVIWKEQQE------------DASLADQLLQHLLYLVDVNDLYNVALGTYDFGLVLFVAQKSQK 841  fruit fly
Q17MG4        783 ITCYVKKG--MLEKVLEVIWDLKKMp----------sKGDDADEALKYLLYLVNVNDLFNVALGMYDFGLVLFVATKSQK 850  yellow fever ...
Q54Q66        846 LTTYVKKSPPELDQVLRLIQSLRGEeineq---getiVNRLAEESLDYIVFLVDVNKLYDIALGTYDFELVIMVAQKSQK 922  Dictyostelium...
Q8WND5        841 LTSHVKKTTPELEIVLQKVHELQGNaps-------dpDAVSAEEALKYLLLLVDVNELYDHSLGTYDFDLVLMVAEKSQK 913  rabbit
XP_001629314  825 LMSYAKKTEPELETVLSIIRDLKNKqvd-------tsLGVTSEEALKYVLFLVDVNQMFDVALGMYDFQLVLMVAEKSQK 897  starlet sea a...
XP_318429     828 ITCHVKQG--QLENALALIWTLKQQq----------qSPEAAEEALRYLLYLVEVNVLYDVALGMYDFGLVLFVATKSQK 895  Anopheles gam...
XP_001359305  789 ITVFVRLG--DVNSALKLIRDLG--------------DPPQEDQLLKYLMYLVDINELYNVALGSYNLETALFVAQKSQK 852  Drosophila ps...
XP_011387076  973 LTTHVRKVPADYEAGLSLLLRLKES------------DPETAEEAVKYIIFLADADKLFDVALGMYDYTLTLMIAQHAKR 1040 Ustilago mayd...
Q9FNA4        912 -DPKEFLPYLQELEKMPESL-MHFKIDIKLQRFDSALRNIVSAG 953  thale cress
O59704        858 -DPREYVPFLHEFQKQESLR-RKFNIDCYLKRYERALGHLKEME 899  Schizosaccharomyces pombe 972h-
Q9VGK7        842 -DPKEFLPYLNDLKALPIDY-RKFRIDDHLKRYTSALSHLAACG 883  fruit fly
Q17MG4        851 -DPKEYLPFLNELKRLDEDY-RKYKIDCHLKRFGKAIENISRYQ 892  yellow fever mosquito
Q54Q66        923 -DPKEYIPFLQELQKMEKFY-QRYSIDKYLSRWELALYNLSRAG 964  Dictyostelium discoideum AX4
Q8WND5        914 -DPKEYLPFLNTLKKMETNY-QRFTIDKYLKRYEKAIGHLSKCG 955  rabbit
XP_001629314  898 -DPKEYLPFLNNLRQMETNY-QRYMIDKHLKRFTKAIKNLSLCG 939  starlet sea anemone
XP_318429     896 -DPKEYLPFLNELKRMEENY-RKYRIDCHLKRYDRALEHIARYE 937  Anopheles gambiae str. PEST
XP_001359305  853 -DPKEFLQYLNELKALPEDY-RKFRIDDNLKRYSSAVQHLARCG 894  Drosophila pseudoobscura pseudoobscura
XP_011387076 1041 kDPREYLPFLRELRSLSPVEyQRFRIDDHLGRHVKALSWLVKAG 1084 Ustilago maydis 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap