Conserved Protein Domain Family
LXG

?
pfam04740: LXG 
LXG domain of WXG superfamily
This domain is present is the N-terminal region of a group of polymorphic toxin proteins in bacteria. It is predicted to use Type VII secretion pathway to mediate export of bacterial toxins.
Statistics
?
PSSM-Id: 309745
View PSSM: pfam04740
Aligned: 40 rows
Threshold Bit Score: 120.072
Threshold Setting Gi: 558690768
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5WDR2         4 KSLDAAQTIDMLQAMASETSDQNGQFAGFSSWMIS-QHLQSGgRLsSGKTATAIANFWSEAHGPFLNLLRDVMDD----- 77  Bacillus clausi...
Q8YAN8         2 SRIDIGEIQAFLYQLRATNEPGRKTIQSIKAAVTK---YVGDnSL-KGKAVDASKNYYQMTYFPLCDAIIEAMDE----- 72  Listeria monocy...
Q8YA28         2 SRIDIAELNDFLHGLRSSNAEAKAMIRKIKEAAMD---YAQDnRL-KGEAVSTSKQYFSSTYTSICQSIIEALDE----- 72  Listeria monocy...
Q8ERI3         4 K-VDISEVIELSEDVNSSTADIKTSLNSISESIDR-LNSLE--SF-SGKTATNAKNYFNDLHKTILVTFEHLFTD----- 73  Oceanobacillus ...
CDD41917       8 lkLDNRSLDSMAEAISSYEETAQDAFYDFYKAAYI----LSAsSHyRGQSADAFKAYMTNGPVNVVTELLDITSD----- 78  Collinsella sp....
WP_015075141   3 K-MDIGEYKHLLSQMKELKLTLGLSFTGTNGTIEE---FSGDtKL-KGVAWSSTKSYFSAGYTPMLDGLSDVFYT----- 72  Carnobacterium ...
WP_023520185   9 ESSD------FMSALKSNLESGKETVSQLKSGSQKvVSAVDGkQL-SGAAYTAGKGLFADLIIPTITRTTNAIEQ----- 76  Enterococcus mu...
CCZ26007       5 ykimyssMDQFYDQTNGRMAEWVSQLEPWVKACEN-LGNME--CY-QGKSAESVKTYLKEVHMTLLTSIQQAIQL----- 75  Ruminococcus to...
CDC23087       3 yhvkIEELLEVQNQIISQLSEWGTQLETVYQALET-IVVTP--CI-QGETGKSIQNYIQEVHIPVIGSLQQLLTE----- 73  Clostridium nex...
CDD41908       4 ydvkyAEVQELFNKFNLFDEELGEAIERVDKRVTE-LVELE--SF-KGAAAESIKRYFAD-HKKILERIQMLAEQlghey 78  Collinsella sp....
Q5WDR2        78 ----FSNKLEQIQNAISD--AFTSEAVLKESFMMDQLYDELDQLKNVVRNFGDALADIK------------NEYSDVLAM 139 Bacillus clausi...
Q8YAN8        73 ----SEERLGQYIQDFHAevDSSPDAKIDADGLY-ELGKMIDRIESKKEALAQRMNS--------------GTEGQM--- 130 Listeria monocy...
Q8YA28        73 ----SEERLAQYIREFGSqvDSSPSARIDAEILQ-EAMAKVSQLQRKEEDLHRQLTA-P------------NTKPDMQQV 134 Listeria monocy...
Q8ERI3        74 ----LDDSLKKHLEMFQSrvDTSESAIIVSDYVK-DLELDIKEDWEKLSLEQDKVRETM------------NSVSDI--- 133 Oceanobacillus ...
CDD41917      79 ----LSMIAKTVKETFLQv-EPNSNGRIGQAELV-NVQQGSDKHAASLEDYKGEINATL------------NQATEYISP 140 Collinsella sp....
WP_015075141  73 ----AITTLENFIRAFESe-VTASGVKLDLDHLQ-DLQRRRDELQREKTNWLHQIAE---------------QASKIPGL 131 Carnobacterium ...
WP_023520185  77 ----IEQELKKYQNADKI---VASEGELNEDKLNQQI--------QVTRTMKNSVDKTLffvrlqttlnpiASVLDTLLN 141 Enterococcus mu...
CCZ26007      76 ----YRTKYLFYREGYYDi-EGDLYAVIPQKTLL-SVKDRMKTEIEDVSDSSLIVQTSL------------LNVSDLIAL 137 Ruminococcus to...
CDC23087      74 ----FQVRLSVYAEGYYGi-DSSYEAEIPQEILE-EQQQVLENGREDFENLREEINSVI------------SSVSDIVSV 135 Clostridium nex...
CDD41908      79 aaayYNEFLAYPIEETHD------DARWPREALKSAQSKMFSIRSASLASADSEIVKAK------------AEAPTGIGF 140 Collinsella sp....
Q5WDR2       140 PSFDDSKIEQGLTKSQEKLQETTAYLYEMDAKMKTPMEYIAEDITLMHTYVDRIRSMISNGSVSIEN 206 Bacillus clausii KSM-K16
Q8YAN8       131 -----QNYRSQLAIAYKQ-ENILEKYLSFEQSHANFFDHLIDLVQAVQQTIRELQSNIQFNSQTGTY 191 Listeria monocytogenes
Q8YA28       135 YAVKSRSVHTQLLKAIEQ-ENILEKYLAFEQSHGQFFSALDELIRATARAVQELLHHVSFNDKTGTY 200 Listeria monocytogenes
Q8ERI3       134 ----TSAIHPNYYPPEADKDDVIKIITNLEQELNSFTSVGQEEISSIEDLLNQVATTIENAGTVEGK 196 Oceanobacillus iheyensis
CDD41917     141 VGLNYSDITAAYQQVDATIDTIDTNLATADQSSKAFVDELYERISKLKLMISNLRTSCYAGGsfnee 207 Collinsella sp. CAG:398
WP_015075141 132 GHLFDDY---SVLQAEKKVQ-LMEDFRDFIHRHDSDFSELNGLIEQVLLGLEELGKQRSFNGDKQGY 194 Carnobacterium maltaromaticum
WP_023520185 142 VERDLQRMTDSFQQAIDHLQNQLRKLQDFNTQTSGLFANSLNELKIAMQGVLILNNTTIKSDGSysl 208 Enterococcus mundtii
CCZ26007     138 QAPNSYYLKDSMEEVKQNVTDFNQNIIDYEAQHKSEANGELADL--LQSLFATLTEYYTNGTNVTSY 202 Ruminococcus torques CAG:61
CDC23087     136 VQPSGLALVLSYQLMESRVKTLNSDIGDYEETHQNDTQNMNSMLESIRSI---LIARTGSPAISVTN 199 Clostridium nexile CAG:348
CDD41908     141 SYPTIDSIVAEMERQEKKTERVTEGIERIENSGKQAFANQESGFSQLATSLSSLIAHYSSGNIDMTS 207 Collinsella sp. CAG:398
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap