Conserved Protein Domain Family
LXG

?
pfam04740: LXG 
LXG domain of WXG superfamily
This domain is present is the N-terminal region of a group of polymorphic toxin proteins in bacteria. It is predicted to use Type VII secretion pathway to mediate export of bacterial toxins.
Statistics
?
Aligned: 40 rows
Threshold Bit Score: 121.609
Threshold Setting Gi: 558609989
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5WDR2          4 KSLDAAQTIDMLQAMASETSDQNGQFAGFSSWMIS-QHLQSGgRLsSGKTATAIANFWSE---AHGPFLNLLRDVMDDFS 79   Bacillus clau...
Q65H85          2 KVFEAHSLIEAANNRKKQYETFEDQLQTLKKAFLG-VADLGD-DF-QGKGADNIKDFYKG----QAEIVDSWLKLVEAQI 74   Bacillus lich...
EIM56723       11 A--------AQCESMIEAFRSEKDKLDGVNRSVDN---FSQDsAL-QGKAWSALKQQMSDyalLSEGLLEANRSMIAD-C 77   [Eubacterium]...
BAO07794        9 ESSD------FMSALKSNLESGKETVSQLKSGSQKvVSAVDGkQL-SGAAYTAGKGLFAD---LIIPTITRTTNAIEQIE 78   Enterococcus ...
WP_015075141    3 K-MDIGEYKHLLSQMKELKLTLGLSFTGTNGTIEE---FSGDtKL-KGVAWSSTKSYFSA---GYTPMLDGLSDVFYTAI 74   Carnobacteriu...
Q8YAN8          2 SRIDIGEIQAFLYQLRATNEPGRKTIQSIKAAVTK---YVGDnSL-KGKAVDASKNYYQM---TYFPLCDAIIEAMDESE 74   Listeria mono...
Q8ERI3          4 K-VDISEVIELSEDVNSSTADIKTSLNSISESIDR-LNSLE--SF-SGKTATNAKNYFND---LHKTILVTFEHLFTDLD 75   Oceanobacillu...
CDD41917        8 lKLDNRSLDSMAEAISSYEETAQDAFYDFYKAAY--ILSASS-HY-RGQSADAFKAYMTN---GPVNVVTELLDITSDLS 80   Collinsella s...
CCZ26007        5 ykimySSMDQFYDQTNGRMAEWVSQLEPWVKACEN-LGNME--CY-QGKSAESVKTYLKE---VHMTLLTSIQQAIQLYR 77   [Ruminococcus...
CDC23087        3 yhvkIEELLEVQNQIISQLSEWGTQLETVYQALET-IVVTP--CI-QGETGKSIQNYIQE---VHIPVIGSLQQLLTEFQ 75   Clostridium n...
Q5WDR2         80 NKLEQIQNAISD--AFTSEAVLKESFMMDQLYDELDQLKNVVRNFGDALAD-IK------------NEYSDVLAMPSFDD 144  Bacillus clau...
Q65H85         75 AFFNGVSGDIKDk-KLS-DSYVEVSFLDHELKNADLKATEIVSGLKLEMDK-II------------ASISDIVDLDNWTL 139  Bacillus lich...
EIM56723       78 QSLSDAVASIED--DPQDEDKLESSIHKLNAANRILQFCKSIAEGAQGIGGgVS------------PTTSQAVWNTIETY 143  [Eubacterium]...
BAO07794       79 QELKKYQNADKI---VASEGELNEDKLNQQI--------QVTRTMKNSVDK-TLffvrlqttlnpiASVLDTLLNVERDL 146  Enterococcus ...
WP_015075141   75 TTLENFIRAFESe-VTASGVKLDLDHLQ-DLQRRRDELQREKTNWLHQIAE----------------QASKIPGLGHLFD 136  Carnobacteriu...
Q8YAN8         75 ERLGQYIQDFHAevDSSPDAKIDADGLY-ELGKMIDRIESKKEALAQRMNS---------------GTEGQM-------- 130  Listeria mono...
Q8ERI3         76 DSLKKHLEMFQSrvDTSESAIIVSDYVK-DLELDIKEDWEKLSLEQDKVRE-TM------------NSVSDI-------T 134  Oceanobacillu...
CDD41917       81 MIAKTVKETFLQv-EPNSNGRIGQAELVN-VQQGSDKHAASLEDYKGEINA-TL------------NQATEYISPVGLNY 145  Collinsella s...
CCZ26007       78 TKYLFYREGYYDi-EGDLYAVIPQKTL-LSVKDRMKTEIEDVSDSSLIVQT-SL------------LNVSDLIALQAPNS 142  [Ruminococcus...
CDC23087       76 VRLSVYAEGYYGi-DSSYEAEIPQEILE-EQQQVLENGREDFENLREEINS-VI------------SSVSDIVSVVQPSG 140  Clostridium n...
Q5WDR2        145 SKIEQGLTKSQEKLQETTAYLYEMDAKMKTPMEYIAEDITLMHTYVDRIRSMISNG 200  Bacillus clausii KSM-K16
Q65H85        140 DDYIDKMSKAQTTRQNTIDAVNKLDESLKTEYTNLQALDSAVLGKYSGLMEATSHG 195  Bacillus licheniformis DSM 13 = ATCC ...
EIM56723      144 QSMIEDNNRSIEKMQEKIRQLQTAETQTNYLFLDADMIFKVVNWGYQSVRGAWSNG 199  [Eubacterium] cellulosolvens 6
BAO07794      147 QRMTDSFQQAIDHLQNQLRKLQDFNTQTSGLFANSLNELKIAMQGVLILNNTTIKS 202  Enterococcus mundtii QU 25
WP_015075141  137 DY---SVLQAEKKVQ-LMEDFRDFIHRHDSDFSELNGLIEQVLLGLEELGKQRSFN 188  Carnobacterium maltaromaticum
Q8YAN8        131 QNYRSQLAIAYKQ-ENILEKYLSFEQSHANFFDHLIDLVQAVQQTIRELQSNIQFN 185  Listeria monocytogenes
Q8ERI3        135 SAIHPNYYPPEADKDDVIKIITNLEQELNSFTSVGQEEISSIEDLLNQVATTIENA 190  Oceanobacillus iheyensis
CDD41917      146 SDITAAYQQVDATIDTIDTNLATADQSSKAFVDELYERISKLKLMISNLRTSCYAG 201  Collinsella sp. CAG:398
CCZ26007      143 YYLKDSMEEVKQNVTDFNQNIIDYEAQHKSEANGELADL--LQSLFATLTEYYTNG 196  [Ruminococcus] torques CAG:61
CDC23087      141 LALVLSYQLMESRVKTLNSDIGDYEETHQNDTQNMNSMLESIR---SILIARTGSP 193  Clostridium nexile CAG:348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap