Conserved Protein Domain Family
Gtr1_RagA

?
pfam04670: Gtr1_RagA 
Gtr1/RagA G protein conserved region
GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologs of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B.
Statistics
?
PSSM-Id: 309695
View PSSM: pfam04670
Aligned: 29 rows
Threshold Bit Score: 241.345
Threshold Setting Gi: 74778069
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122123569  59 KLLLMGPARAGKTSMRSIIFDNYLPRDTLRLAITISHEESRVRLLNNMYVNLWDCGGQQQYVAE--YLNRQRECIFRNVG 136
gi 75030489   10 KVLLMGLRKSGKSSIQKVVFEGMQPHDSATLATTVQPEKSTVHSNDFVNFEVWDFPGQNDPFDSsnASRYDVNQLLENCG 89
gi 122112086  10 KVLLMGLRKSGKTSIQKVVFEGMQPHHCVDLTTTVQPEKSTVCSYDFVNFEVWDFPGQTDPFDLnnTVHYDVGVLLENCG 89
gi 122094849  41 RILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIVKDDINNSSFVQFQIWDFPGQIDFFDP--T--FDSDMIFGGCG 116
gi 74854229   40 KIFLMGLKRSGKSSIQKVVFHKMLPNETLFLESTSKVVKNDISNSSFVQFQIWDFPGQLDFFDP--S--FDYEYILNNCG 115
gi 74626869    5 KIILMGLRRSGKSSIQKVVFYKMPPNETLFLESTSKLTQDHI--SSFIDFSVWDFPGQVDVFDA--A--FDFESIFTQVG 78
gi 74634679   16 KVLLMGLRRSGKSSICKVVFHNMQPLDTLYIESTSKPVEEEF--NSLIDFSVQELPGQLNFFEP--DQYIDSDRLFQNVG 91
gi 268536470  28 TVILMGHKRSGKTSIRKVVFQKMSPNETMFVESTARITRDTIC-SSFINFETIEFPGQMCPFDD--S--LDPIGIFQKCE 102
gi 149246562  15 TILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTSKPTNEQF--SSLIDLSVMELPGQLNYFEP--N--YDSERLFSSVG 88
gi 156037806  74 RLLLMGQRRSGKSSISSVVFHKMPPNETLFLESTARIQKDSM--HSFMDFQVWDFPGQIDFQDA--Q--FDVEAIFGEIG 147
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122123569 137 VLLFVFDISsmsreesdvfggktSeqN-LRDTFQYFREAVQHVRTYSPQAKVFVLLHKMDVIQQKLRSSIFESRKREILK 215
gi 75030489   90 AIVYVLDCR-----------------ElIDDARARLLDTISAAYRHNPELCVEVFIHKVDALSEDHQADLLASLQRRVEE 152
gi 122112086  90 AIVFVMDCG-----------------ElIDDSHARLVETVCAAYDRDPELSVEVFIHKVDKLSEDHQADLLTSLQRRVEA 152
gi 122094849 117 ALVFVIDAQ-----------------DeYIEALAKLNQTVTKAHKVNPRIKFEVFIHKVDGVSDDFKMESQRDIHSRATD 179
gi 74854229  116 AIVFVIDAQ-----------------DeIIEALQKLHQTIAKVYQINPNIHFEVFIHKSDGLSDDHKIDRQRDIQQKTTE 178
gi 74626869   79 ALIFVIDAQ-----------------DdYLDALARLHVTVARVVTINPNICIEVFIHKVDGLSDEFKIDTQRDIQQRTQD 141
gi 74634679   92 ALVYVIDSQ--------------D--E-YLNALSNLHNIIEYAFKINPDINVEVLIHKVDGLSEDFRLDTQRDIMQRVSD 154
gi 268536470 103 ALLFIIDAQ-----------------AeLQEPIATLVEYFCRAYKINQNIKFEVFVHKADGLTEEARVETKFNIYHQVKE 165
gi 149246562  89 ALVYVIDSQ-----------------DeYLNALTNLSMIIDFAYRVNPKINIEVLIHKVDGLSEDYRMDAQQDIMQRTGD 151
gi 156037806 148 ALIWVIDAQ-----------------DdYLEAIARLNSTIFNLHQSFPNINIEVFIHKVDGLSDDYMLDIQRDIMQRIQD 210
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122123569 216 EVENVGGSgg--dVQFFATSIYDDTLYLAYSNIVRSLI-PHCDVLTRAMEKLLVSCNASEVALYERGTFLCLTYVSKIDA 292
gi 75030489  153 EAKPLLENvqplrLNFNLTSIYDHSVFQAFSLVVQKLIkSKTPYITELLQMLNSNSNIDLSYLFLSHSKIYVAVDERNRL 232
gi 122112086 153 EARQRLNAtaqlrLNFNLTSIYDHSVFQAFSSVVQKLMkLQIPYITELLQILNSNSNLDLSYLFLSRSKIFLSVDERNRV 232
gi 122094849 180 DLADAGLEgv--hLSFHLTSIYDHSIFEAFSKVVQKLI-PQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDC-SPV 255
gi 74854229  179 ELADANInv---hPSFYVTSIYDHSIFEAFSKVIQKLI-PQLPTLENLLDVFISRSRIEKAFLVDVVSKIYVATDN-SPV 253
gi 74626869  142 ELADIGLEnv--pISFHLTSIFDHSIFEAFSRVIQKLI-PQLPTLENLLNIFCSNSLVEKAYLFDVLSKIYVATDS-SPV 217
gi 74634679  155 ELVDARLDdgdvkLNFHLTSIFDHSIYEAFSRIIQKLI-PELPVFENLLNVLCSHSLFEKVFLFDVNSKIYVATDS-SPV 232
gi 268536470 166 TIKDQIDVdl--qVTYHLTSIYDHSIFEAFSKVVQNLV-KQLPTLERLLDVFNNSSKVTKSFLFDILSKIYIATDS-EPV 241
gi 149246562 152 ELLDLGLEgv--sVSFYLTSIFDHSIYEAFSRIVQRLI-PELPSLEHMLDNLVQHSNIDKVFLFDVNSKIYVATDS-LPV 227
gi 156037806 211 ELSDQGMEna--pVNFHLTSIYNHSIFEAFSKVIQKLI-PHLATLEALLNDLCRNCRFEKAYLFDVLSKIYIATDS-SPV 286
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 122123569 293 AaadngsliaeddgsnrgdrcsgtesRTTKVSETV 327
gi 75030489  233 Ks-----------------------rTYDLCSDAI 244
gi 122112086 233 Kt-----------------------rTYEICSDAI 244
gi 122094849 256 Dm-----------------------qSYELCCDMI 267
gi 74854229  254 Dm-----------------------qTYELCSDMI 265
gi 74626869  218 Dv-----------------------qSYEICSDFI 229
gi 74634679  233 Dn-----------------------qTYEVCTDFI 244
gi 268536470 242 Em-----------------------sIYELCCDMI 253
gi 149246562 228 Di-----------------------qTYEVCAEFI 239
gi 156037806 287 Dm-----------------------pCYEICSDYI 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap