6CES,6CES


Conserved Protein Domain Family
Gtr1_RagA

?
pfam04670: Gtr1_RagA 
Click on image for an interactive view with Cn3D
Gtr1/RagA G protein conserved region
GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologs of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B.
Statistics
?
Aligned: 31 rows
Threshold Bit Score: 240.564
Threshold Setting Gi: 74778069
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CES_A     9 KVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNL--VLNLWDCGGQDTFMEN--YFTSQRDNIFRN 84  cattle
Q38A82    10 KVLLMGLRKSGKTSIQKVVFEGMQPHHCVDLTTTVQPEKSTVCSYDFV--NFEVWDFPGQTDPFDLnnTVHYDVGVLLEN 87  Trypanosoma brucei
Q17AT2    41 RILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIVKDDINNSSFV--QFQIWDFPGQIDFFDP--T--FDSDMIFGG 114 yellow fever mosquito
Q54PK6    40 KIFLMGLKRSGKSSIQKVVFHKMLPNETLFLESTSKVVKNDISNSSFV--QFQIWDFPGQLDFFDP--S--FDYEYILNN 113 Dictyostelium disco...
EDN97763  74 RLLLMGQRRSGKSSISSVVFHKMPPNETLFLESTARIQKDSM--HSFM--DFQVWDFPGQIDFQDA--Q--FDVEAIFGE 145 Sclerotinia sclerot...
O74544     5 KIILMGLRRSGKSSIQKVVFYKMPPNETLFLESTSKLTQDHI--SSFI--DFSVWDFPGQVDVFDA--A--FDFESIFTQ 76  Schizosaccharomyces...
Q6C9K9    16 KVLLMGLRRSGKSSICKVVFHNMQPLDTLYIESTSKPVEEEF--NSLI--DFSVQELPGQLNFFEP--DQYIDSDRLFQN 89  Yarrowia lipolytica
EDK42061  15 TILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTSKPTNEQF--SSLI--DLSVMELPGQLNYFEP--N--YDSERLFSS 86  Lodderomyces elongi...
CAP26263  28 TVILMGHKRSGKTSIRKVVFQKMSPNETMFVESTARITRDTIC-SSFI--NFETIEFPGQMCPFDD--S--LDPIGIFQK 100 Caenorhabditis brig...
Q5CV88    69 LIMLCGLGSSGKTSIIKVLYDKVSPHETVSLYPTQSGSITLIKNESKIlpCFGIIDLPGTGQIQDS-----LLGEDIFSK 143 Cryptosporidium parvum
6CES_A    85 VEVLIYVFDVEsRE--LEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQ---EDQRDLIFKEREEDLRRLSRPLE--- 156 cattle
Q38A82    88 CGAIVFVMDCG--El-IDDSHARLVETVCAAYDRDPELSVEVFIHKVDKLS---EDHQADLLTSLQRRVEAEARQRLnat 161 Trypanosoma brucei
Q17AT2   115 CGALVFVIDAQ--De-YIEALAKLNQTVTKAHKVNPRIKFEVFIHKVDGVS---DDFKMESQRDIHSRATDDLADAGleg 188 yellow fever mosquito
Q54PK6   114 CGAIVFVIDAQ--De-IIEALQKLHQTIAKVYQINPNIHFEVFIHKSDGLS---DDHKIDRQRDIQQKTTEELADANin- 186 Dictyostelium disco...
EDN97763 146 IGALIWVIDAQ--Dd-YLEAIARLNSTIFNLHQSFPNINIEVFIHKVDGLS---DDYMLDIQRDIMQRIQDELSDQGmen 219 Sclerotinia sclerot...
O74544    77 VGALIFVIDAQ--Dd-YLDALARLHVTVARVVTINPNICIEVFIHKVDGLS---DEFKIDTQRDIQQRTQDELADIGlen 150 Schizosaccharomyces...
Q6C9K9    90 VGALVYVIDSQ-DE--YLNALSNLHNIIEYAFKINPDINVEVLIHKVDGLS---EDFRLDTQRDIMQRVSDELVDARldd 163 Yarrowia lipolytica
EDK42061  87 VGALVYVIDSQ--De-YLNALTNLSMIIDFAYRVNPKINIEVLIHKVDGLS---EDYRMDAQQDIMQRTGDELLDLGleg 160 Lodderomyces elongi...
CAP26263 101 CEALLFIIDAQ--Ae-LQEPIATLVEYFCRAYKINQNIKFEVFVHKADGLT---EEARVETKFNIYHQVKETIKDQIdvd 174 Caenorhabditis brig...
Q5CV88   144 VSSLVFVIDSQ--NypYNTEILRAKRLFQNAIQVKPGITFEVFLHKTDNETfslDGAHLESQRDIHEKISSFIFQHGfe- 220 Cryptosporidium parvum
6CES_A   157 ----CACFRTSIWDETLYKAWSSIVYQLI-PNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQrdvhRFEKI 231 cattle
Q38A82   162 aqlrLNFNLTSIYDHSVFQAFSSVVQKLMkLQIPYITELLQILNSNSNLDLSYLFLSRSKIFLSVDERNRVkt-rTYEIC 240 Trypanosoma brucei
Q17AT2   189 --vhLSFHLTSIYDHSIFEAFSKVVQKLI-PQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDC-SPVdm-qSYELC 263 yellow fever mosquito
Q54PK6   187 --vhPSFYVTSIYDHSIFEAFSKVIQKLI-PQLPTLENLLDVFISRSRIEKAFLVDVVSKIYVATDN-SPVdm-qTYELC 261 Dictyostelium disco...
EDN97763 220 --apVNFHLTSIYNHSIFEAFSKVIQKLI-PHLATLEALLNDLCRNCRFEKAYLFDVLSKIYIATDS-SPVdm-pCYEIC 294 Sclerotinia sclerot...
O74544   151 --vpISFHLTSIFDHSIFEAFSRVIQKLI-PQLPTLENLLNIFCSNSLVEKAYLFDVLSKIYVATDS-SPVdv-qSYEIC 225 Schizosaccharomyces...
Q6C9K9   164 gdvkLNFHLTSIFDHSIYEAFSRIIQKLI-PELPVFENLLNVLCSHSLFEKVFLFDVNSKIYVATDS-SPVdn-qTYEVC 240 Yarrowia lipolytica
EDK42061 161 --vsVSFYLTSIFDHSIYEAFSRIVQRLI-PELPSLEHMLDNLVQHSNIDKVFLFDVNSKIYVATDS-LPVdi-qTYEVC 235 Lodderomyces elongi...
CAP26263 175 --lqVTYHLTSIYDHSIFEAFSKVVQNLV-KQLPTLERLLDVFNNSSKVTKSFLFDILSKIYIATDS-EPVem-sIYELC 249 Caenorhabditis brig...
Q5CV88   221 --idIRYHFTSIYNDSLLEAFSKVTQKIS-PFTQILEKLLDVLVISSSLEKAFLMDIYSRTFVASDS-SLFdp-iGFELC 295 Cryptosporidium parvum
6CES_A   232 SNII 235 cattle
Q38A82   241 SDAI 244 Trypanosoma brucei
Q17AT2   264 CDMI 267 yellow fever mosquito
Q54PK6   262 SDMI 265 Dictyostelium discoideum AX4
EDN97763 295 SDYI 298 Sclerotinia sclerotiorum 1980 UF-70
O74544   226 SDFI 229 Schizosaccharomyces pombe 972h-
Q6C9K9   241 TDFI 244 Yarrowia lipolytica
EDK42061 236 AEFI 239 Lodderomyces elongisporus NRRL YB-4239
CAP26263 250 CDMI 253 Caenorhabditis briggsae
Q5CV88   296 ADIL 299 Cryptosporidium parvum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap