Conserved Protein Domain Family
Gtr1_RagA

?
pfam04670: Gtr1_RagA 
Gtr1/RagA G protein conserved region
GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologs of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B.
Statistics
?
PSSM-Id: 309695
View PSSM: pfam04670
Aligned: 29 rows
Threshold Bit Score: 241.345
Threshold Setting Gi: 74778069
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q386H9        59 KLLLMGPARAGKTSMRSIIFDNYLPRDTLRLAITISHEESRVRLLNNMYVNLWDCGGQQQYVAE--YLNRQRECIFRNVG 136 Trypanosoma brucei
Q4Q0H2        10 KVLLMGLRKSGKSSIQKVVFEGMQPHDSATLATTVQPEKSTVHSNDFVNFEVWDFPGQNDPFDSsnASRYDVNQLLENCG 89  Leishmania major
Q38A82        10 KVLLMGLRKSGKTSIQKVVFEGMQPHHCVDLTTTVQPEKSTVCSYDFVNFEVWDFPGQTDPFDLnnTVHYDVGVLLENCG 89  Trypanosoma brucei
Q17AT2        41 RILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIVKDDINNSSFVQFQIWDFPGQIDFFDP--T--FDSDMIFGGCG 116 yellow fever mo...
Q54PK6        40 KIFLMGLKRSGKSSIQKVVFHKMLPNETLFLESTSKVVKNDISNSSFVQFQIWDFPGQLDFFDP--S--FDYEYILNNCG 115 Dictyostelium d...
O74544         5 KIILMGLRRSGKSSIQKVVFYKMPPNETLFLESTSKLTQDHI--SSFIDFSVWDFPGQVDVFDA--A--FDFESIFTQVG 78  Schizosaccharom...
Q6C9K9        16 KVLLMGLRRSGKSSICKVVFHNMQPLDTLYIESTSKPVEEEF--NSLIDFSVQELPGQLNFFEP--DQYIDSDRLFQNVG 91  Yarrowia lipoly...
XP_002633370  28 TVILMGHKRSGKTSIRKVVFQKMSPNETMFVESTARITRDTIC-SSFINFETIEFPGQMCPFDD--S--LDPIGIFQKCE 102 Caenorhabditis ...
XP_001527719  15 TILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTSKPTNEQF--SSLIDLSVMELPGQLNYFEP--N--YDSERLFSSVG 88  Lodderomyces el...
XP_001586630  74 RLLLMGQRRSGKSSISSVVFHKMPPNETLFLESTARIQKDSM--HSFMDFQVWDFPGQIDFQDA--Q--FDVEAIFGEIG 147 Sclerotinia scl...
Q386H9       137 VLLFVFDISsmsreesdvfggktSeqN-LRDTFQYFREAVQHVRTYSPQAKVFVLLHKMDVIQQKLRSSIFESRKREILK 215 Trypanosoma brucei
Q4Q0H2        90 AIVYVLDCR-----------------ElIDDARARLLDTISAAYRHNPELCVEVFIHKVDALSEDHQADLLASLQRRVEE 152 Leishmania major
Q38A82        90 AIVFVMDCG-----------------ElIDDSHARLVETVCAAYDRDPELSVEVFIHKVDKLSEDHQADLLTSLQRRVEA 152 Trypanosoma brucei
Q17AT2       117 ALVFVIDAQ-----------------DeYIEALAKLNQTVTKAHKVNPRIKFEVFIHKVDGVSDDFKMESQRDIHSRATD 179 yellow fever mo...
Q54PK6       116 AIVFVIDAQ-----------------DeIIEALQKLHQTIAKVYQINPNIHFEVFIHKSDGLSDDHKIDRQRDIQQKTTE 178 Dictyostelium d...
O74544        79 ALIFVIDAQ-----------------DdYLDALARLHVTVARVVTINPNICIEVFIHKVDGLSDEFKIDTQRDIQQRTQD 141 Schizosaccharom...
Q6C9K9        92 ALVYVIDSQ--------------D--E-YLNALSNLHNIIEYAFKINPDINVEVLIHKVDGLSEDFRLDTQRDIMQRVSD 154 Yarrowia lipoly...
XP_002633370 103 ALLFIIDAQ-----------------AeLQEPIATLVEYFCRAYKINQNIKFEVFVHKADGLTEEARVETKFNIYHQVKE 165 Caenorhabditis ...
XP_001527719  89 ALVYVIDSQ-----------------DeYLNALTNLSMIIDFAYRVNPKINIEVLIHKVDGLSEDYRMDAQQDIMQRTGD 151 Lodderomyces el...
XP_001586630 148 ALIWVIDAQ-----------------DdYLEAIARLNSTIFNLHQSFPNINIEVFIHKVDGLSDDYMLDIQRDIMQRIQD 210 Sclerotinia scl...
Q386H9       216 EVENVGGSgg--dVQFFATSIYDDTLYLAYSNIVRSLI-PHCDVLTRAMEKLLVSCNASEVALYERGTFLCLTYVSKIDA 292 Trypanosoma brucei
Q4Q0H2       153 EAKPLLENvqplrLNFNLTSIYDHSVFQAFSLVVQKLIkSKTPYITELLQMLNSNSNIDLSYLFLSHSKIYVAVDERNRL 232 Leishmania major
Q38A82       153 EARQRLNAtaqlrLNFNLTSIYDHSVFQAFSSVVQKLMkLQIPYITELLQILNSNSNLDLSYLFLSRSKIFLSVDERNRV 232 Trypanosoma brucei
Q17AT2       180 DLADAGLEgv--hLSFHLTSIYDHSIFEAFSKVVQKLI-PQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDC-SPV 255 yellow fever mo...
Q54PK6       179 ELADANInv---hPSFYVTSIYDHSIFEAFSKVIQKLI-PQLPTLENLLDVFISRSRIEKAFLVDVVSKIYVATDN-SPV 253 Dictyostelium d...
O74544       142 ELADIGLEnv--pISFHLTSIFDHSIFEAFSRVIQKLI-PQLPTLENLLNIFCSNSLVEKAYLFDVLSKIYVATDS-SPV 217 Schizosaccharom...
Q6C9K9       155 ELVDARLDdgdvkLNFHLTSIFDHSIYEAFSRIIQKLI-PELPVFENLLNVLCSHSLFEKVFLFDVNSKIYVATDS-SPV 232 Yarrowia lipoly...
XP_002633370 166 TIKDQIDVdl--qVTYHLTSIYDHSIFEAFSKVVQNLV-KQLPTLERLLDVFNNSSKVTKSFLFDILSKIYIATDS-EPV 241 Caenorhabditis ...
XP_001527719 152 ELLDLGLEgv--sVSFYLTSIFDHSIYEAFSRIVQRLI-PELPSLEHMLDNLVQHSNIDKVFLFDVNSKIYVATDS-LPV 227 Lodderomyces el...
XP_001586630 211 ELSDQGMEna--pVNFHLTSIYNHSIFEAFSKVIQKLI-PHLATLEALLNDLCRNCRFEKAYLFDVLSKIYIATDS-SPV 286 Sclerotinia scl...
Q386H9       293 AaadngsliaeddgsnrgdrcsgtesRTTKVSETV 327 Trypanosoma brucei
Q4Q0H2       233 Ks-----------------------rTYDLCSDAI 244 Leishmania major
Q38A82       233 Kt-----------------------rTYEICSDAI 244 Trypanosoma brucei
Q17AT2       256 Dm-----------------------qSYELCCDMI 267 yellow fever mosquito
Q54PK6       254 Dm-----------------------qTYELCSDMI 265 Dictyostelium discoideum AX4
O74544       218 Dv-----------------------qSYEICSDFI 229 Schizosaccharomyces pombe 972h-
Q6C9K9       233 Dn-----------------------qTYEVCTDFI 244 Yarrowia lipolytica
XP_002633370 242 Em-----------------------sIYELCCDMI 253 Caenorhabditis briggsae
XP_001527719 228 Di-----------------------qTYEVCAEFI 239 Lodderomyces elongisporus NRRL YB-4239
XP_001586630 287 Dm-----------------------pCYEICSDYI 298 Sclerotinia sclerotiorum 1980 UF-70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap