6CES,6ULG


Conserved Protein Domain Family
Gtr1_RagA

?
pfam04670: Gtr1_RagA 
Gtr1/RagA G protein conserved region
GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologs of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B.
Statistics
?
PSSM-Id: 398377
View PSSM: pfam04670
Aligned: 30 rows
Threshold Bit Score: 241.332
Threshold Setting Gi: 74778069
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CES_A         9 KVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMEN--YFTSQRDNIFRNVE 86 
Q4Q0H2        10 KVLLMGLRKSGKSSIQKVVFEGMQPHDSATLATTVQPEKSTVHSNDFVNFEVWDFPGQNDPFDSsnASRYDVNQLLENCG 89  Leishmania major
Q38A82        10 KVLLMGLRKSGKTSIQKVVFEGMQPHHCVDLTTTVQPEKSTVCSYDFVNFEVWDFPGQTDPFDLnnTVHYDVGVLLENCG 89  Trypanosoma brucei
XP_002633370  28 TVILMGHKRSGKTSIRKVVFQKMSPNETMFVESTARITRDTIC-SSFINFETIEFPGQMCPFDD--S--LDPIGIFQKCE 102 Caenorhabditis ...
EDN97763      74 RLLLMGQRRSGKSSISSVVFHKMPPNETLFLESTARIQKDSM--HSFMDFQVWDFPGQIDFQDA--Q--FDVEAIFGEIG 147 Sclerotinia scl...
O74544         5 KIILMGLRRSGKSSIQKVVFYKMPPNETLFLESTSKLTQDHI--SSFIDFSVWDFPGQVDVFDA--A--FDFESIFTQVG 78  Schizosaccharom...
Q6C9K9        16 KVLLMGLRRSGKSSICKVVFHNMQPLDTLYIESTSKPVEEEF--NSLIDFSVQELPGQLNFFEP--DQYIDSDRLFQNVG 91  Yarrowia lipoly...
EDK42061      15 TILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTSKPTNEQF--SSLIDLSVMELPGQLNYFEP--N--YDSERLFSSVG 88  Lodderomyces el...
Q17AT2        41 RILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIVKDDINNSSFVQFQIWDFPGQIDFFDP--T--FDSDMIFGGCG 116 yellow fever mo...
Q54PK6        40 KIFLMGLKRSGKSSIQKVVFHKMLPNETLFLESTSKVVKNDISNSSFVQFQIWDFPGQLDFFDP--S--FDYEYILNNCG 115 Dictyostelium d...
6CES_A        87 VLIYVFDVEsRE-LEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLE-------CA 158
Q4Q0H2        90 AIVYVLDCR--ElIDDARARLLDTISAAYRHNPELCVEVFIHKVDALSEDHQADLLASLQRRVEEEAKPLLenvqplrLN 167 Leishmania major
Q38A82        90 AIVFVMDCG--ElIDDSHARLVETVCAAYDRDPELSVEVFIHKVDKLSEDHQADLLTSLQRRVEAEARQRLnataqlrLN 167 Trypanosoma brucei
XP_002633370 103 ALLFIIDAQ--AeLQEPIATLVEYFCRAYKINQNIKFEVFVHKADGLTEEARVETKFNIYHQVKETIKDQIdvd--lqVT 178 Caenorhabditis ...
EDN97763     148 ALIWVIDAQ--DdYLEAIARLNSTIFNLHQSFPNINIEVFIHKVDGLSDDYMLDIQRDIMQRIQDELSDQGmen--apVN 223 Sclerotinia scl...
O74544        79 ALIFVIDAQ--DdYLDALARLHVTVARVVTINPNICIEVFIHKVDGLSDEFKIDTQRDIQQRTQDELADIGlen--vpIS 154 Schizosaccharom...
Q6C9K9        92 ALVYVIDSQ-DE-YLNALSNLHNIIEYAFKINPDINVEVLIHKVDGLSEDFRLDTQRDIMQRVSDELVDARlddgdvkLN 169 Yarrowia lipoly...
EDK42061      89 ALVYVIDSQ--DeYLNALTNLSMIIDFAYRVNPKINIEVLIHKVDGLSEDYRMDAQQDIMQRTGDELLDLGleg--vsVS 164 Lodderomyces el...
Q17AT2       117 ALVFVIDAQ--DeYIEALAKLNQTVTKAHKVNPRIKFEVFIHKVDGVSDDFKMESQRDIHSRATDDLADAGleg--vhLS 192 yellow fever mo...
Q54PK6       116 AIVFVIDAQ--DeIIEALQKLHQTIAKVYQINPNIHFEVFIHKSDGLSDDHKIDRQRDIQQKTTEELADANin---vhPS 190 Dictyostelium d...
6CES_A       159 CFRTSIWDETLYKAWSSIVYQLI-PNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQrdvhRFEKISNII 235
Q4Q0H2       168 FNLTSIYDHSVFQAFSLVVQKLIkSKTPYITELLQMLNSNSNIDLSYLFLSHSKIYVAVDERNRLks-rTYDLCSDAI 244 Leishmania major
Q38A82       168 FNLTSIYDHSVFQAFSSVVQKLMkLQIPYITELLQILNSNSNLDLSYLFLSRSKIFLSVDERNRVkt-rTYEICSDAI 244 Trypanosoma brucei
XP_002633370 179 YHLTSIYDHSIFEAFSKVVQNLV-KQLPTLERLLDVFNNSSKVTKSFLFDILSKIYIATDS-EPVem-sIYELCCDMI 253 Caenorhabditis br...
EDN97763     224 FHLTSIYNHSIFEAFSKVIQKLI-PHLATLEALLNDLCRNCRFEKAYLFDVLSKIYIATDS-SPVdm-pCYEICSDYI 298 Sclerotinia scler...
O74544       155 FHLTSIFDHSIFEAFSRVIQKLI-PQLPTLENLLNIFCSNSLVEKAYLFDVLSKIYVATDS-SPVdv-qSYEICSDFI 229 Schizosaccharomyc...
Q6C9K9       170 FHLTSIFDHSIYEAFSRIIQKLI-PELPVFENLLNVLCSHSLFEKVFLFDVNSKIYVATDS-SPVdn-qTYEVCTDFI 244 Yarrowia lipolytica
EDK42061     165 FYLTSIFDHSIYEAFSRIVQRLI-PELPSLEHMLDNLVQHSNIDKVFLFDVNSKIYVATDS-LPVdi-qTYEVCAEFI 239 Lodderomyces elon...
Q17AT2       193 FHLTSIYDHSIFEAFSKVVQKLI-PQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDC-SPVdm-qSYELCCDMI 267 yellow fever mosq...
Q54PK6       191 FYVTSIYDHSIFEAFSKVIQKLI-PQLPTLENLLDVFISRSRIEKAFLVDVVSKIYVATDN-SPVdm-qTYELCSDMI 265 Dictyostelium dis...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap