Conserved Protein Domain Family
Pox_A32

?
pfam04665: Pox_A32 
Poxvirus A32 protein
The A32 protein is thought to be involved in viral DNA packaging.
Statistics
?
PSSM-Id: 282513
View PSSM: pfam04665
Aligned: 8 rows
Threshold Bit Score: 274.317
Threshold Setting Gi: 81970475
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6TUP8   6 EKHFYRKSLLKHPFRIALVGGSGSGKTAYLLSLFNTFVEKY-RHIFLFTP----VYNSEYDSYIWPDHVNRVTTYEE--- 77  Yaba monkey tumor virus
Q98306   6 EARFARASLLRAPFRMALVGGSGSGKTLYLLSLFRTLVGAY-RHIFLFTP----VLNSAYDGYVWPDHIQKVSSHEE--- 77  Molluscum contagiosum...
Q9EMP9   1 MSEFDYDKLRAKPFNMAIIGKTGSGKTTFLKNLLLKIGYGFyKFIYLITSsevnFKSNEYFKFIYPNHVFYLYSNNKdkd 80  Amsacta moorei entomo...
Q6TVL2   6 EVRFKRESLIEAPFRMALVGGSGSGKTAYLLSLFRTLVRRF-KHILLFTP----VYNAAYDGFVWPDHIHKVTTHEE--- 77  Orf virus
Q8V3H8   6 EKHFFRRSLNKSPFRLALVGGSGSGKTMYLLSLFSTLIDKY-KHIFLFTP----VYNEAYDSYIWPDHVNKVTTSEE--- 77  Swinepox virus
P68615   6 EKQFSRENLLKMPFRMVLTGGSGSGKTIYLLSLFSTLVKKY-KHIFLFTP----VYNPDYDGYIWPNHINFVSSQES--- 77  Vaccinia virus WR
Q9J536   6 EVKFNRNSLLNDYFRMVILGGSGSGKTTFLLSLFKTFITKY-KHIFLFTP----ILNPSYNYYVWPDHIYKITTAEE--- 77  Fowlpox virus
Q06ZZ7   7 EVRFDRNSLLADDFRLVFLGGSGSGKTVYLLSLLRGMVRKF-RHVFLMLP----VPNSAYDGYVWPDHITTVANEHQ--- 78  Crocodilepox virus
Q6TUP8  78 LDYSLITTKQKIEKYVKKQGNDKtt-eMFLLILDDMGDKQIRSSCLLDFLNHGRHLNTSIILLCQTYKHVPVNGRTSITH 156 Yaba monkey tumor virus
Q98306  78 LEYTLSVAKKKIERYVAGSRGGE----RFLLILDDLGDMQLRSRTLLGLLNYGRHLNVSLAMLCQTYKHVPVNGRASITH 153 Molluscum contagiosum...
Q9EMP9  81 VKYLLQAYLEKIKNFSF-EMNQKcenfRTLVIYDDIGK-DTKDK-LSNFTNVCRHSLVSNIFLVHRLEHLDTTTRDSLSY 157 Amsacta moorei entomo...
Q6TVL2  78 LEYNLSVAKRKIERHAQ-TKKQK-----FLIILDDMGDTQTRSPTLLGLMNYGRHINVSLVLLCQTYKHIPVNGRASITH 151 Orf virus
Q8V3H8  78 LEYSLVTTKQKIEKYIE-SKGTKna-dMFLIILDDMGDKQTRSSCLLDLLNHGRHLNISIILLCQTYKHVPVNGRTSITH 155 Swinepox virus
P68615  78 LEYNLIRTKSNIEKCIAVAQNHKks-aHFLLIFDDVGDKLSKCNTLIEFLNFGRHLNTSIILLCQTYRHVPILGRANITH 156 Vaccinia virus WR
Q9J536  78 LEYSLSKMKQDLVNLGKRGSINH----KFLVILDDLGDMQLKSKILSWLVNTGRHIRMSIVMLCQTYRHVPSNCRSSITH 153 Fowlpox virus
Q06ZZ7  79 LDYALLRYKAFAEELAKSASRRK----AVLLVLDDLGDLQYRSRELAPIFNHGRHVNISVAVLCQTFRHIPHSCKTSITH 154 Crocodilepox virus
Q6TUP8 157 FCCCNVSDSDIENMLRSMSITGSKKDLLKSVSLMRSVSvNKRRVI-IIEDSVFSEGEQRVCYDTADDDVIKNNVNFSILL 235 Yaba monkey tumor virus
Q98306 154 LCCCNVSESDVENMMRSMSIKGSKKLLLQAMAVMRGAL-KARQVL-IVEDSVFCDGEQRICYDAADERVLARELDTSILL 231 Molluscum contagiosum...
Q9EMP9 158 HV-INSESENMDLIPCNKNLR--NSLLASVINIFKDREqSKYYIYcIIYDSV----S-YSCLISDDDLENIKNEDKYVFY 229 Amsacta moorei entomo...
Q6TVL2 152 LCCCNVSDSDVENVLRSMSIRGSKKRLIRAMAIMRSA--GTRRVL-IIEDSVFCQNQERICYDFADESVVKRCLDPGILL 228 Orf virus
Q8V3H8 156 FCCCNVSDSDIENMLRSMSIVGSKKDLLKSISIMRSSIaGRRRVL-IIEDSVFSEGEQRICFDSADEHVINNDVNPIILL 234 Swinepox virus
P68615 157 FCSFNISISDAENMLRSMPVKGKRKDILNMLNMIQTARsNNRLAI-IIEDSVFCEGELRICTDTADKDVIEQKLNIDILV 235 Vaccinia virus WR
Q9J536 154 LCCCNVSDADIENITRSMSLVATKQ-IIKALSVMRAAS-RGKKVY-IIENTVFANKDIRICYDTADKSVIEQKPDTAILL 230 Fowlpox virus
Q06ZZ7 155 LVCCSVVMNDLENLLKYMSVAVEKKKLLRFVDMFCSNN-KKRKVL-IVENSLFSGGRARVCTDVVDKRVLAGELDLDVLR 232 Crocodilepox virus
Q6TUP8 236 KQFSHMKKQLP 246 Yaba monkey tumor virus
Q98306 232 RQFSHMKSQLP 242 Molluscum contagiosum virus subtype 1
Q9EMP9 230 TD-SVIKSHIL 239 Amsacta moorei entomopoxvirus 'L'
Q6TVL2 229 AQFSHMKTRLA 239 Orf virus
Q8V3H8 235 KQFSHMKKNLP 245 Swinepox virus
P68615 236 NQYSHMKKNLN 246 Vaccinia virus WR
Q9J536 231 SQFSHMKDQLH 241 Fowlpox virus
Q06ZZ7 233 AQFSRMRANLK 243 Crocodilepox virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap