2BT7


Conserved Protein Domain Family
Reo_sigmaC

?
pfam04582: Reo_sigmaC 
Click on image for an interactive view with Cn3D
Reovirus sigma C capsid protein
Statistics
?
Aligned: 4 rows
Threshold Bit Score: 237.129
Threshold Setting Gi: 83754431
Created: 20-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BT7_A  41 LMQFRWMARGTNGSSDTIDMTVNAHCHGRRTDYMMSSTGNLTVTSNVVLLTFDLSDITHIPSDLARLVPSAGFQAASFPV 120 Avian orthoreovirus
Q83931 197 LMQFQWSVKGEDGATNSIDMDVNAHCHGPRTDYLMSTKQSLTITASPATLVFELDRITKLPPDLSRLIPCHGFQQATFPV 276 Orthoreovirus S1
Q9DPB4 197 LMQFQWLARGEDGSSSSVDMLVNRHCHGRRTDYMMSTTESFTVTGNSVSLVFNLDYITKPPSDMSRLVPRAGFQAASFPV 276 Avian orthoreovirus
Q9DPB5 197 LMQFQWMAKGTSGSSDVIDMTVNAHCHGRRTDYMMSSTGGLTVTSNAVSLTFSLDYITNMPSDLSRLIPSVGFQAASFPV 276 Avian orthoreovirus
2BT7_A 121 DVSFTRDSATHAYQAYGVYSSSRVFTITFPTGGDGTANIRSLTVRTGIDT 170 Avian orthoreovirus
Q83931 277 DISFQRDGVSHSYQVYGTYTSSRVFKITFSPGASGPAVIQFLTVRTGIDT 326 Orthoreovirus S1
Q9DPB4 277 DVSFTRDTTTHAYQVYGAFSSPRVFKITFLTGGTGTANLRFLTVRTGIDT 326 Avian orthoreovirus
Q9DPB5 277 DVSFTRDSATHSYQVYGAYSSARVFTITFPTGGNGTSNIRFLTVRTGIDT 326 Avian orthoreovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap