Conserved Protein Domain Family
Reo_sigmaC

?
pfam04582: Reo_sigmaC 
Reovirus sigma C capsid protein
Statistics
?
PSSM-Id: 113356
View PSSM: pfam04582
Aligned: 4 rows
Threshold Bit Score: 512.926
Threshold Setting Gi: 75568157
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9DPB5     1 MAGLNPLQRREVVSLILSLTSSTTTNPGDLTAVYERLTNLEASTKSLRQSLSSIVSDLSDVSVDLQDTTRALDDAIATLK 80  Avian orthoreovirus
Q83931     1 MDGLTQQQRREVVGLILSLTSSVTINPGDLTQIRERLSALESANASLSESVNTALSRLTDLSAALGNMATSVAEMKVELN 80  Orthoreovirus S1
Q9DPB4     1 MAGLTPSQRREVVGLILSLTSSANTNCGDLTPVYDRLLSLESAVASLDGSVGVLSQKVSDLESDLQGVVSSLGQANSTLT 80  Avian orthoreovirus
AAF45153   1 MAGLNPSQRREVVSLILSLTSNVTISHGDLTPIYERLTNLEASTELLHRSISDISTTVSNISANLQDMTHTLDDVTANLD 80  ARV-176
Q9DPB5    81 GLNTTVAALQNSVASLSSTVNGLTDISSAHSEALSFLRTTIDGNTVAISNLKGDVSTNGLNIADLQNRMKSLESSTSHGL 160 Avian orthoreovirus
Q83931    81 SLISDVQALRTSLDSSSSELASLSLLVHDHDSSISDLQKESHALSGDITNLNSSVSAQGLTISSLEQRVQALEGGSSTSL 160 Orthoreovirus S1
Q9DPB4    81 ELSKELRQLSSSVDNLMTSLSDLSTTVSGNQAAIAGIQTSVHANTTDISNLKSSVSAISLNITDLERRVGDIESGSGPNL 160 Avian orthoreovirus
AAF45153  81 GLRTTVTALQDSVSILSTNVTDLTNTSSAHAATLSSLQTTVDGNSTAISNLKSDVSSNGLAITDLQDRVKSLESTASHGL 160 ARV-176
Q9DPB5   161 SFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAKLMQFQWMAKGTSGSSDVIDMTVNAHCHGRRTDYMMSSTGGLTVT 240 Avian orthoreovirus
Q83931   161 LFADPLKLEAGTVSLELDPYFCSVSRNLTSYSADAQLMQFQWSVKGEDGATNSIDMDVNAHCHGPRTDYLMSTKQSLTIT 240 Orthoreovirus S1
Q9DPB4   161 RFVSPLSLSQGVVSLVMDPYFCSDNQALTSYSTDAQLMQFQWLARGEDGSSSSVDMLVNRHCHGRRTDYMMSTTESFTVT 240 Avian orthoreovirus
AAF45153 161 SFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAQLMQFRWMARGTNGSSDTIDMTVNAHCHGRRTDYMMSSTGNLTVT 240 ARV-176
Q9DPB5   241 SNAVSLTFSLDYITNMPSDLSRLIPSVGFQAASFPVDVSFTRDSATHSYQVYGAYSSARVFTITFPTGGNGTSNIRFLTV 320 Avian orthoreovirus
Q83931   241 ASPATLVFELDRITKLPPDLSRLIPCHGFQQATFPVDISFQRDGVSHSYQVYGTYTSSRVFKITFSPGASGPAVIQFLTV 320 Orthoreovirus S1
Q9DPB4   241 GNSVSLVFNLDYITKPPSDMSRLVPRAGFQAASFPVDVSFTRDTTTHAYQVYGAFSSPRVFKITFLTGGTGTANLRFLTV 320 Avian orthoreovirus
AAF45153 241 SNVVLLTFDLSDITHIPSDLARLVPSAGFQAASFPVDVSFTRDSATHAYQAYGVYSSSRVFTITFPTGGDGTANIRSLTV 320 ARV-176
Q9DPB5   321 RTGIDT 326 Avian orthoreovirus
Q83931   321 RTGIDT 326 Orthoreovirus S1
Q9DPB4   321 RTGIDT 326 Avian orthoreovirus
AAF45153 321 RTGIDT 326 ARV-176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap