4WIS


Conserved Protein Domain Family
Anoctamin

?
pfam04547: Anoctamin 
Click on image for an interactive view with Cn3D
Calcium-activated chloride channel
The family carries eight putative transmembrane domains, and, although it has no similarity to other known channel proteins, it is clearly a calcium-activated ionic channel. It is expressed in various secretory epithelia, the retina and sensory neurons, and mediates receptor-activated chloride currents in diverse physiological processes.
Statistics
?
PSSM-Id: 335826
View PSSM: pfam04547
Aligned: 344 rows
Threshold Bit Score: 138.482
Threshold Setting Gi: 124460065
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WIS_A        177 IRDKFGESVAFYFAFLRSYFRFLVIPSAFGFGAWL----LL-G--Q-FSYLYAL-LCGLWSVVFFEYWKKQEVDLAVQW- 246
gi 511005009  252 IRNHFGEKIAYYFAFLQNYFLWLSVPAAVGILVYLths-------ntLAIWFSL-FMLLWAILFTEMWKRKEAELAIKW- 322
gi 384501189  215 IRDHFGEKIAYYFAFLQNYFLWLSAPSFMGIFVYLtht-------ntLALWYSF-AMIFWAVVFIEIWKRKEKELSIQW- 285
gi 552917315  200 LRNHFGEKIAYYFAFLQYYCVWLIVPSIVGLFTWLtl--------seYSIFYGV-SIALWSIVFVEFWRRKEYELSVWW- 269
gi 299745509  168 VRAQFGDAVAYYFAFLSSYTTFLVFPAILGIFAHYvl----lP----YSPIYSF-LIAIWATFFVEWWRVHERILALRF- 237
gi 597973319  169 IRDQFGDSVGLYFAFLSSYTQFLAFPAILGLFSYFfl----sP----YSSVYSI-LLCIWSVGFVEYWKVRERILSLRF- 238
gi 630211307  175 VRQQFGESIAVYFAFLNTYTHFLAFPACLGLSFYFlv----tP--SsYSPIYSS-LLVLWSIIFVEYWRVRERLIAVKF- 246
gi 568029274  359 LRYNFGEKVAYYFAFLKYYNTWLIPLAAIGILLELlrgvISmtsymrLLPFWGLgVSVVWGFGFLKSWERENACMQYDWt 438
gi 568019427  247 VRAHFGEKVGYYFAFMDFYNKALVPIALLGVLLTClrgvMGtpvymrVLVGWAVlISVVWSFGFLKAWSRRNNELNHMWa 326
gi 972976184  191 IQAYFGENVGLYFGFFGYFIRALLLKSILFLFLYFfp----iQ--SnARLVFSLfFNILWFSLFLEGWKHRRNMLTLEW- 263
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WIS_A        247 ---GV-RG-VSSIQQSRPEFEWEHEAEdpit--gepVkvYPPMKR-VKTQLLQIP--FA-----LACVVALG--ALIVTc 309
gi 511005009  323 ---GV-RN-YSKHEKRRAEFKGEKMVKdhvtgedvpF--VSAWKLlGR-RVAAVP--GV-----AIGAFLLS--IIVGFv 385
gi 384501189  286 ---GV-RN-YSKNEKRRTEFKGDMWIKdqvtgedkpE--VSAYKLlGR-RLASIP--GV-----AAGAVFLS--VIVGFv 348
gi 552917315  270 ---GV-RN-YSRVERCRPTFQEEYYIPdpitgenkpY--FSPWRRwLR-RAVAAP--II-----IMFSLTLS--VTLLFy 332
gi 299745509  238 ---GT-RN-SFRVEKRRAQYKq----------------gVPWWRReLR-IFLTLP--VI-----LVFGAALF--AILTGi 286
gi 597973319  239 ---GT-RG-SFRVEKCRVTYRp----------------gQTWWGReLR-IFASLP--VI-----LLFAGVLV--ALLTSi 287
gi 630211307  247 ---GT-LG-SFRVEKRRIGLEqng---------kkvK--AKWWQKeLK-VLASVP--VI-----TLFAVILG--LVMTGi 300
gi 568029274  439 gklHVkQIeYR-----NKQFYGESR-VnaltgetelV--YPAWRr-LPKYFCVFLfmLLqmlimL---ILVAswVTIYEi 506
gi 568019427  327 nniDThTIvYR-----NPKFRGEAF-VnpvtglpdqY--YPSWKr-YPKYLAVVTfmIVqisimM---FIIAiwITAFEv 394
gi 972976184  264 ---GTsER-REERQVAVGGNNRI-MGInltfghqkiI--SFSRELyFKTLLLSIP--FV-----VTSLFVSA--GLIVFy 327
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WIS_A        310 NSLEVFINEV--YsgpgkqYLG-----------FLPTIFLVIGTPTI-S-GVLMGAAEKLNAMENYATVDAHDAALIQKQ 374
gi 511005009  386 FILQLFLHE---Y------YNGpfak----flhYAPTVGYVLFIPNM-T-KIYSKWVKTLTDWEMQKTDAQWEYSYTQKI 450
gi 384501189  349 FALQLFLHE---Y------YNGpfhq----flhYTPTVGYVLLIPTM-T-AIYSKWMKTLNDWEMHKTSASYEYHYTQKI 413
gi 552917315  333 ILLNVIMSD---Y------YDGpfre----elmYLPTVAYCALVPAL-N-MFYTKIARRLNEYENYETESYYEFNLSQKI 397
gi 299745509  287 FVFEAFITH---L------YQGpgkq----iigFSPTILFVVLVPRF-L-ALYHALAVRLTNWENHAHQSTYTFSMTLKT 351
gi 597973319  288 FVFEAFVTQ---L------YQGpgkk----lisFSPTLLFAALVPRV-L-QLYQALAVGLTTWENHRHQSSYNKSLTLKT 352
gi 630211307  301 FILEAFVGQ---L------YMGpgqk----vvaFSPTVLFILLVPRI-V-GVFQACTVRLTIWENHSHQSSHDKSLARKT 365
gi 568029274  507 LKatykesyifs---------------vqwllilleGIVFGFFVDVVqWnMVVTKMGALFTHWENYRTEEQYEKALIRKL 571
gi 568019427  395 LKvrypdrgifs---------------aqwfyilggGILYGLFVDIIqWsVIVTKAARMFTEWENWKTIEQFEKSMIRKL 459
gi 972976184  328 IH----LESIesK------YHFreksccgvplySLPEVSLTVAMLLL-N-RVYIELAKQLTEWENHESDVLHQKSLVAKL 395
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WIS_A        375 FVLNFMTSYMALFFTAFVYIPFGHILHPFLNFWR---------------------------------------------- 408
gi 511005009  451 FIANFLVGYLSLFITAWIYIPFGDHVLPYLTNL----------------------------------------------- 483
gi 384501189  414 FIANFLVGYLSLFITAWIYIPFGDHVLPYLVQY----------------------------------------------- 446
gi 552917315  398 FISNFLIGNLSIFFIGWIYIPFNYEIGQYFGSFFe--------------------------------------------- 432
gi 299745509  352 FALGALVAYSGLALSAFVYVPFGEGVMHLVQRLLfdpskagsasglaamissvlngt-------tsglevsekdtaaggt 424
gi 597973319  353 FALSAIVAYMALGLSAFVYVPFGQSVMRYVQNRLfttpvesgsrsgfgakivgllngttvdstatttgftseklsnvgal 432
gi 630211307  366 FVFTALVAYLGLALSAFVYVPFGEGIMRVVQMWLykstvtipdsgeqv------------------------dqmladgs 421
gi 568029274  572 FLLDFLNYYTWFFSLAFVFV--IPGLGNYLTNTFnhmffgdemnccfgpyvd-----------------qdgsctmcpvg 632
gi 568019427  460 FLMDFLNYYTWFFLLAFVYV--IPGAGDTITNFLntliwkdpanccfgpymdrsg-----------aycdscppawnemg 526
gi 972976184  396 VIFYFFNNFGVHFYTAFY----LQ-------------------------------------------------------- 415
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WIS_A        409 ------ATaqtltfsekeLPTREFQINP-ARISNQMFYFTVTAQIVnFATEVVvpyikqqafqkakqlksgs-------- 473
gi 511005009  484 -------N----------ISHDHKTVDF-QRLRAQLVYFIVTGQLVgFLTEMVvpyalkkfvpkakkmvnkkkstapste 545
gi 384501189  447 -------N----------ISHDHKTVDF-QRLRSQLVYFIVTGQLVgFLTEMVvpyvlnlikpkaqriterimkkeetp- 507
gi 552917315  433 -----iFG----------LSVTIEPVGP-ERLMNELKYFVLTGQIMsLFMEIAlpyllragavgvkkiqrttt------- 489
gi 299745509  425 hlglwdMD----------TMNARNKLNP-ARLRDQMFAFTVTNQIVnTFTEVGlpfvlrgvntflkkgkptngngdslk- 492
gi 597973319  433 ksslweRD----------MSNARRKLNP-TRLRDQMFAYTVTNQVInSFTEVGlpyimryvtafrhrhdknatkpgspsg 501
gi 630211307  422 sagvptFF----------DMSKEHKLDS-ARLRNQMFAYTVTNQIVnTFQEVGlpfilrkisaitskkshsssidspsdg 490
gi 568029274  633 dkdancIE----------CVGFFTFDRRhVDLSAMFVTPIVITQSLnILLRLVapilvrkrrekaqaradaqaqkrvrea 702
gi 568019427  527 lretrcIP----------CRGWVTFDINhLDLETLFLTPIIITQLLnLLIAVAvpwihrkhyeqrlrgtdrkvmamvkaq 596
gi 972976184  416 --------------------------DL-DKLRKHMVAQFVTYQILcEVSQSIlsflmtrkrhgrelvrs---------- 458
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WIS_A        474 -------------------------------------------------------kvqedheeeaeflqrvreeCTLEEY 498
gi 511005009  546 ------------------------------------------------slsekssvaavqdeeeeklmnkvykeVAMDEY 577
gi 384501189  508 -------------------------------------------------satdlakkeaedeeeqkfmtkvyneVALQEY 538
gi 552917315  490 -------------------------------------------------------kddarnedesaflkrirkeAKLPVY 514
gi 299745509  493 ------------------------------------------------kkvvfedekerggleeraylerirseAALPEY 524
gi 597973319  502 e---------------------------------------------pkkrvvfedekerggmeervfldhvreeVALPEY 536
gi 630211307  491 nst-----------------------------------------tsstkkvsfederpssspaekallsktlheLSLPPY 529
gi 568029274  703 gsmkilgsldyen----------------------qkesqfgnksssryleytpseievlnkkarqilfdseqdT-YDPY 759
gi 568019427  597 gerhllaemsyrtedsddahshdvsdrsstidrssnnlahllnrssarylenserevellnakarailfeseqeN-YDPY 675
gi 972976184  459 ----------------------------------------------------------gqdqlqplvlcqiqlqSCKSVY 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WIS_A        499 D-VSGDYREMVMQFGYVAMFSVAWPLAACCFLVNNWVELRSDALKIAISSRRPIPWRTDSIGPWLTALSFLSWLGSITSS 577
gi 511005009  578 A-IYTDYVEMVIQFGYVSMFSTVWPLTALCAMINNWVELRGDAAKICKYTRRPIPHRAESIGPWLGNMETLVWLSSITMA 656
gi 384501189  539 N-IYLDYAEMVTQFGYVSMFSTVWPLTALFCMINNWVELRGDAVKVCKYTRRPIPTRAESIGPWLGNMETLIWFSSITMS 617
gi 552917315  515 D-IFEDYAEIITQFGYVSLFSVIWPLTPIAALINNLVELRSDAIKLCVHTRRPIPHRADSIGPWLENLELLTWLSAITNP 593
gi 299745509  525 D-LFADYNEMVVQFGYVALWSTIWPLAGAMAFINNIFELRSDAFKITVHHRRPMPVRTDTIGPWLDALTFLTWLSALTNS 603
gi 597973319  537 D-LFADYSEMVIQFGYVVLWSTIWPLAGVMAFINNIVELRGDAFKMTVHHRRPIPTRADSIGPWLEALSFLAWLGALTNS 615
gi 630211307  530 D-VFSDYSEMIIQFGYVALWSTIWPLAPVMALLNNILEIRSDAFKITTHVRRPIPLRTESIGPWLEALTFLTWLAGVTNG 608
gi 568029274  760 ----DDFHVLTVQYGFTVMFSMLWPLMPFACFLINSVKGRTDGYRLCKTLKRPIPRRANGIGAWKGILTTYAYIAVIVNV 835
gi 568019427  676 ----DDYHHMTVQFGFVVMFSMLWPLMPAACMIVNALKTRGDGFRLCRTNRRPFPRKASGIGEWHSMLHVLALTGVIVNI 751
gi 972976184  481 EsEQDDYLDLFLSFCYMIFFSSVYPHATILCLLYNLTKILRDSWRFCSVLRRPFPGPATTNKIWHQAFERFEAIALVTNV 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WIS_A        578 AIV----------------------------------------------------------YLCSNSK------------ 587
gi 511005009  657 SFAylfhpst---------------------------------------------------------------------- 666
gi 384501189  618 SFAylfhptt---------------------------------------------------------------------- 627
gi 552917315  594 SLLylyhpts---------------------------------------------------------------------- 603
gi 299745509  604 ALLylfspsllstpfqtlvnvtdtdapasdakltaeehlvaaaggtgspnawgvdasaspsNVGA--------------- 668
gi 597973319  616 ALVylfspellksspl--------------------------------alndeddqlntetNT-A--------------- 647
gi 630211307  609 ALVwlfcprectaggrresavdrvhrkl--------fdaaraaasatddaeksssvniwadSAKA--------------- 665
gi 568029274  836 LLI--------------------------------------------------------------CIStgvleffdetcv 853
gi 568019427  752 GLI--------------------------------------------------------------FIStgtmeff--sps 767
gi 972976184  561 ALVwvsp---------------------------------------------------efhQFFK--------------- 574
                         650       660       670       680       690       700       710
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
4WIS_A        588 ---NGTQ------------GEASPLKAWGLLLSILF-AEHFYLVVQLAVRFVLSK-Ld----SPGLQKERKER 639
gi 511005009  667 -------------------qihssytPVFTLLAILV-SEHLFIALRFGVRKAFNl-Ip----SMAEWLVRKEE 714
gi 384501189  628 -------------------nihsvytPIFTLLAILL-SEHIYVAIRIGVQQGIRVlLp----NWSEWKVQREE 676
gi 552917315  604 -------------------kafssasLIVMMALIFC-TEHIFSIVRYIVRQMMSa-Ip----SSADDYIKSQE 651
gi 299745509  669 ---------------------TKELLLKAALVALV--ASHVYIIVKALIRHVVEK-IwwkgsSEVAEKEREEV 717
gi 597973319  648 ---------------------TKELVVKAVLVALV--ASHGYFILRAVVRHVVER-IwwigsKEVQLNEREER 696
gi 630211307  666 ---------------------TIELLGTALLVALI--ASHVYSIVRFGVRHVVER-VvwgesREREEKEREER 714
gi 568029274  854 idiEHQLekqgktlddfvfGPNFGCLHIAWRLLFILlLEHLFVTVAYVGMQRIPH-V-----PSWIKNVMSSR 920
gi 568019427  768 cskQITYamggdf-shyrfGPDFACFSLTTRMVMILvSEHLSLLLIWSFWKIIRS-V-----PANVQLDMLRQ 833
gi 972976184  575 ---------------------E--YSTTHLLMALVA-LEHVMLALRSTVVSLILF-I-----SQEVRTRIRRM 617
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap