1SIG


Conserved Protein Domain Family
Sigma70_ner

?
pfam04546: Sigma70_ner 
Click on image for an interactive view with Cn3D
Sigma-70, non-essential region
The domain is found in the primary vegetative sigma factor. The function of this domain is unclear and can be removed without loss of function.
Statistics
?
PSSM-Id: 335825
View PSSM: pfam04546
Aligned: 219 rows
Threshold Bit Score: 64.1444
Threshold Setting Gi: 123723232
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1SIG_A        29 PEAITYLLEQYNRVEAEEARLSDLITgfVDpnaeEDLAPTATHVGSElsqedlDDDEd--EDEE----DGDDDSADDDNS 102 Escherichia col...
WP_044956245 438 PTTINEILEHIQKVRDGKAQIEEIVDglISd--dGEEYAGSG----A------ADADe--ESEEaqtgG----MSSLQIE 499 Taylorella equi...
WP_008864952 349 PTTIVAILEDAEKVRNGTMQIDQIVDglVD----GLDEEASEQVAED------DESTd----------IGASGMTAGQID 408 Parasutterella ...
CDE49867     105 PTTIREILADAKRIREGTLSIDEVVDgiNDpe---------------------neKKd--DFADigasG----MTAGQLE 157 Sutterella sp. ...
WP_016473779 455 PVTVHEILESAERIRSGETPIDEVVDgiVT-----PDDQKNVVGAVE------DETD-----------MGASAMTVGQLE 512 Sutterella wads...
CDE77173     259 PLSIQELLVLAQKIREESETIDNVIDgfTD-----VAGEEIQDDSGD------LNTD-----------IGAAAMTVEQLE 316 Sutterella sp. ...
WP_016473780 319 PIAVEEILRLGEALKDENTAVDTVVDgfND----AAAEENANSSADE------IATD-----------IGAAAMTVDQLA 377 Sutterella wads...
CDD72393     336 PMAVEELIRQSEQLKDDASAIDQVIDgfTD----TKELADVDEDDAA------VQTD-----------IGAAAMTSEQLE 394 Sutterella sp. ...
WP_049686479 174 PFVMDSLLKIRDQLQSGELTIDNVADgfNE-----PEGTEEVAEGDS------SNGD-----------IGAAGMTTEQLS 231 Sutterellaceae ...
CDE77174     211 PSALKTLVDMADMLRADEVSVEAIVDgvTD----EDIDSISMAEEKM------PEYDeeaDDDVqevsIGASAMSSEQLK 280 Sutterella sp. ...
1SIG_A       103 IDPELAREKFAELRAQYVVTRDTIKAKGR-SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKL 181 Escherichia col...
WP_044956245 500 KLREESLAKFDRVQKAFDKMKAEYEKGRF-QSQAYNKANQQIHDEISGVRFTAKMVEKLAEILRKQIERVRELEKAMISV 578 Taylorella equi...
WP_008864952 409 ELKTVVLAKLDHCKELYQDLKHAYEAEGY-RSPAFIKAQDAIQEELLSLRFTANTVERLCTMLKTQVEEVRKYESRIYDI 487 Parasutterella ...
CDE49867     158 ELKERVLKIFDRVGKQFEEIKAIYERDRS-RSPAFIEKQEEIRKELSQVRFTAKAVDRLCGTLRKTIEQIRNIEKEIKGL 236 Sutterella sp. ...
WP_016473779 513 DLKEKSLAVFDRVEAHFRSLVETFDGKGP-HAPELEGLKDQIQRELMEIRFTAKTADRLCESLRRTIGIVRGSERTVYDE 591 Sutterella wads...
CDE77173     317 EMKERALEMFDRLKGYLETMRESFGDPa--KKKDFERARQNISDELSIVRFSVKTVTHLADILAEHMSKVTDTMYAMRDV 394 Sutterella sp. ...
WP_016473780 378 EMRARVLSLFELARKSLDRVRETYGDPk--REKEYRKALADMSAALSPIRFSVKLVTQMTDHISQHMDEVNNTLKKMRAT 455 Sutterella wads...
CDD72393     395 EMRDRALKLFAVCAKEIEKIRASFGVPg--KEAQYDKARAKIAEELAPVRFAVKTVMHLADVIGAHMDKVNDSLHRLRNA 472 Sutterella sp. ...
WP_049686479 232 DMKDRVVSIITECEDHYKLVKEYFPDPe--QHAAYSRERRAVVKGLSQIRFSGKIVSSLSDQVTEHVSGVNKLLSRMRAL 309 Sutterellaceae ...
CDE77174     281 VLKETTLDILDTCKGYFDCMSQ-----LPvDSDQYRQLEVAVKEQLMRVRFTASTVRTLSDLLHDKAEAFKRIEQDAQRL 355 Sutterella sp. ...
1SIG_A       182 cVEQCKMPKKNFITLF-TGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQI 238 Escherichia coli K-12
WP_044956245 579 cVDKVGMPREHFIDSF-PGNETNLEWVNDELKKKPKYAEKLERSIPDIHEIQQKFIDL 635 Taylorella equigenitalis
WP_008864952 488 vVNRAKMPRELFLKEF-LDNETNLAWSQAIAESDKPYAIDVKRKLPEIQHLQQQLQNI 544 Parasutterella excrementihominis
CDE49867     237 aVDRSGIDLNFFLSDF-MKHETDLNWGKRLLESGKPFVPVFRRNLPAIEQLQQRLIDM 293 Sutterella sp. CAG:351
WP_016473779 592 yVRHLHLPREWFLANF-ISNATRIGWVDEVAAAYPDKAQVILHMRATVEEEQRRLAQL 648 Sutterella wadsworthensis
CDE77173     395 mVNKAHMPQERFVKGF-NERCCDRQWLNDEVASGESWSAALEQHRGVFEELQARLIGL 451 Sutterella sp. CAG:521
WP_016473780 456 lANQCRMPQVQVVELLkSDGVTDPECFEKISAAGKPWSDAVSHSMAVLKEEQAVLISA 513 Sutterella wadsworthensis
CDD72393     473 mVDRSGMPVQQFLADM-NDRCMDEKWVDELAAAGKPYSVKIGLNRELILHLQEELRQA 529 Sutterella sp. CAG:397
WP_049686479 310 aVDDCGIPIDKFLKDF-DHRATDPDWFPSIVRQGVSYSKRVERQEAVLMAMQEGLRNe 366 Sutterellaceae bacterium ND3
CDE77174     356 lVDVVGMPKAEFGRLF-RDEGFSEVALRACLKSDRPYVLALEKNFDSILHVQSvyssl 412 Sutterella sp. CAG:521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap