Conserved Protein Domain Family
BTV_NS2

?
pfam04514: BTV_NS2 
Bluetongue virus non-structural protein NS2
This family includes NS2 proteins from other members of the Orbivirus genus. NS2 is a non-specific single-stranded RNA-binding protein that forms large homomultimers and accumulates in viral inclusion bodies of infected cells. Three RNA binding regions have been identified in Bluetongue virus serotype 17 at residues 2-11, 153-166 and 274-286. NS2 multimers also possess nucleotidyl phosphatase activity. The precise function of NS2 is not known, but it may be involved in the transport and condensation of viral mRNAs.
Statistics
?
PSSM-Id: 282383
View PSSM: pfam04514
Aligned: 2 rows
Threshold Bit Score: 753.113
Threshold Setting Gi: 138940
Created: 20-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P23065   1 MEQKQRRFTKNIFVLDVTAKTLCGAIAKLSSQPYCQIKIGRVVAFKPVKNPEPKGYVLNVPGPGAYRIQDGQDIISLMLT 80  Bluetongue virus (ser...
P23065   1 MEQKQRRFTKNIFVLDVTAKTLCGAIAKLSSQPYCQIKIGRVVAFKPVKNPEPKGYVLNVPGPGAYRIQDGQDIISLMLT 80  Bluetongue virus (ser...
P23065  81 PHGVEATTERWEEWKFEGVSVTPMATRVQYNGVMVDAEIKYCKGMGIVQPYMRNDFDRNEMPDLPGVMRSNYDIRELRQK 160 Bluetongue virus (ser...
P23065  81 PHGVEATTERWEEWKFEGVSVTPMATRVQYNGVMVDAEIKYCKGMGIVQPYMRNDFDRNEMPDLPGVMRSNYDIRELRQK 160 Bluetongue virus (ser...
P23065 161 IKNERESAPRLQVHSVAPREESRWMDDDEAKVDDEAKEIVPGTSGLEKLREARSNVFKEVEAVINWNLDERDEGDRDERG 240 Bluetongue virus (ser...
P23065 161 IKNERESAPRLQVHSVAPREESRWMDDDEAKVDDEAKEIVPGTSGLEKLREARSNVFKEVEAVINWNLDERDEGDRDERG 240 Bluetongue virus (ser...
P23065 241 DEEQVKTLSDDDDQGEDASDDEHPKTHITKEYIEKVAKQIKLKDERFMSLSSAMPQASGGFDRMIVTKKLKWQNVPLYCF 320 Bluetongue virus (ser...
P23065 241 DEEQVKTLSDDDDQGEDASDDEHPKTHITKEYIEKVAKQIKLKDERFMSLSSAMPQASGGFDRMIVTKKLKWQNVPLYCF 320 Bluetongue virus (ser...
P23065 321 DESLKRYELQCVGACERVAFVSKDMSLII 349 Bluetongue virus (serotype 10 / American isolate)
P23065 321 DESLKRYELQCVGACERVAFVSKDMSLII 349 Bluetongue virus (serotype 10 / American isolate)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap