Conserved Protein Domain Family
SAPS

?
pfam04499: SAPS 
SIT4 phosphatase-associated protein
This family includes a conserved region from a group of yeast proteins that associate with the SIT4 phosphatase. This association is required for SIT4's role in G1 cyclin transcription and for bud formation. This family also includes homologous regions from other eukaryotes.
Statistics
?
Aligned: 49 rows
Threshold Bit Score: 231.368
Threshold Setting Gi: 71984227
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KIS68733                       215 NGAYLERKPIEMLEFIKEQPRIVERFVAHLETPAVVDLLFRIIQMEETmrtpVQTTDIIDWLSS-QDLVSRTVDLLA--- 290  Ustilago maydis 521...
Q22CQ3                         223 vlslVQMKPQEMIEYILTSQGVLDGLFRHINNQSIASVVQTLLILESN----KFSSQTQEFLKDfTDIKVKAIGEFI--- 295  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  326 NKN----KDIEVIEYLYKNENNLLNMTKQMQSRSCSDILVKSISFTNQ----KLKEKFLNIK---LKVIDKLIELLS--- 391  Tetrahymena thermophila SB210...
Q43540                          94 VECLMFHKVTPLVRYFQGHPEIFHELVDLIGIASIKEVLIQLIGADSKkdafSPPAELVHLLEE-IDLLEAILDKFS--- 169  trumpet lily...
Q8L7T5                         129 VICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIMEVLVRLVGADDQv--yPNFLDVMQWLAD-SNLLEMIVDKLK--- 202  thale cress...
Q4STI5                         128 IGNLITRKTEQVLAFLRQKEGFLSLVLKHIDTSAMMDVLLRLISCVEPp---LLRLETLTVGDKrTRVHVKPLAVAErge 204  spotted green pufferfish...
Q9UPN7                         128 MGILINRKTDQLVSFLRKKDDFVDLLLQHIGTSAIMDLLLRLLTCVERp---QLRQDVVNWLNE-EKIVQRLIEQIH--- 200  human...
Q6PCI0                         128 MGILINRKTEQIIAFLRKKDDFVSLLLQHIGTSAIMDLLLRLLTCVEQp---QLRQDVFNWLNE-EKIVQRLIEMIH--- 200  African clawed frog...
Q922D4                         128 LSILISRKPEQIVDFLKKKRDFVDLIIKHIGTSAIMDLLLRLLTCIEPp---QPRQDVLNWLNE-ERIIQRLVEIVH--- 200  house mouse...
Q4RZH1                         128 LSILIGRKPERIVEFLRKQEDFVDLMIKHIGTSAIMDLLLRMLTCIEPq---QLRQDVLCWLNE-EKVIQRLVDMVQ--- 200  spotted green pufferfish...
KIS68733                       291 ----------PNYSVDI-HNTVSELLKAIIALSAPSPAALNQGQGQdlggglgeaqenaaginNRLVRELASEPIVRKMV 359  Ustilago maydis 521...
Q22CQ3                         296 ----------DKFGEY-----CSEEIQNLALIFTEIISKYYLIQDG-----------------KEMLEYLCSEESVEKIF 343  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  392 ----------DENNDLEvFANTVLCFQELISYYTNYTDG------------------------KQIVEYVISQPIFSKLL 437  Tetrahymena thermophila SB210...
Q43540                         170 ----------SS-DSSIvQANATNILCAII------------DYAP-----------------SQIAAKIYSPSFVRRLF 209  trumpet lily...
Q8L7T5                         203 ----------PSSPPEV-QANAAETLCAI---SRNAP--------------------------SALATQLSSPGYVAKIF 242  thale cress...
Q4STI5                         205 araethrahsPREDEEr-QSNASQTLCDIIRLSRDQANQLQELSQP-----------------DPLLAVLESQESVEQLL 266  spotted green pufferfish...
Q9UPN7                         201 ----------PSKDENq-HSNASQSLCDIIRLSREQMIQVQDSPEP-----------------DQLLATLEKQETIEQLL 252  human...
Q6PCI0                         201 ----------PTKDDNq-HSNASQSLCDIIRLSREQMIQIQDSPDP-----------------DQLLATLEEQETIEQLL 252  African clawed frog...
Q922D4                         201 ----------PSQEEDr-HSNASQSLCEIVRLSRDQMLQVQNSTEP-----------------DPLLATLEKQEIIEQLL 252  house mouse...
Q4RZH1                         201 ----------PSQDEDVrHSNASQSLCEIIRLSRDQMFQVQGCSEP-----------------DPLLATLEKQETVEQLL 253  spotted green pufferfish...
KIS68733                       360 GYMLdsqmprqlhrrltdvvdeqlsqlsvqdlrkpsqrrdaalstleegvasssaldddeddnesfarplnprefpaseS 439  Ustilago maydis 521...
Q22CQ3                         344 KFMI---------------------------------------------------------------------------H 348  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  438 NNSTs--------------------------------------------------------------------------Q 443  Tetrahymena thermophila SB210...
Q43540                         210 DHAL---------------------------------------------------------------------------N 214  trumpet lily...
Q8L7T5                         243 GHAL---------------------------------------------------------------------------E 247  thale cress...
Q4STI5                         267 QNMY---------------------------------------------------------------------------S 271  spotted green pufferfish...
Q9UPN7                         253 SNMF---------------------------------------------------------------------------E 257  human...
Q6PCI0                         253 SNMF---------------------------------------------------------------------------E 257  African clawed frog...
Q922D4                         253 SNIFh--------------------------------------------------------------------------K 258  house mouse...
Q4RZH1                         254 SNIF---------------------------------------------------------------------------D 258  spotted green pufferfish...
KIS68733                       440 RspgqidhrgstatvrpdnlfppvsaptvpitaeTCSSTLVTCIGVFIELIRKNNS-DYfeqhllrtlhnhlvkrqselt 518  Ustilago maydis 521...
Q22CQ3                         349 G-----------------------------------SDGAKNGACQIIQALAQYYAfNA--------------------- 372  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  444 Na--------------------------------KIAYHNASVVCIIIQLFNVIESrRS--------------------- 470  Tetrahymena thermophila SB210...
Q43540                         215 Ds-------------------------------qPIKTVLIQSLAVFISLLDSERL-AS--------------------- 241  trumpet lily...
Q8L7T5                         248 Ds--------------------------------HSKSGLVHSLSVCTSLLDPRRS-AV--------------------- 273  thale cress...
Q4STI5                         272 Ae--------------------------------GTDGCIVSGIQVLLTLLEIRRP-VV--------------------- 297  spotted green pufferfish...
Q9UPN7                         258 Ge--------------------------------QSQSVIVSGIQVLLTLLEPRRP-RS--------------------- 283  human...
Q6PCI0                         258 Ge--------------------------------HNESVIVNGTQVLLTLLEPRRP-RS--------------------- 283  African clawed frog...
Q922D4                         259 E---------------------------------KNESAIVSAIQILLTLLETRRP-TF--------------------- 283  house mouse...
Q4RZH1                         259 Ke--------------------------------KNESAIVSVIQILLTLFETRRP-AF--------------------- 284  spotted green pufferfish...
KIS68733                       519 ekrlqkkeEEEAAMPKSTqqqgeaagsaeaekqddgelaqkamdtldeeEEDVQGMEEAmaeivdkmglVHLGP-MLRVL 597  Ustilago maydis 521...
Q22CQ3                         373 --------NSFISGYPEG-------------------------------SEYYMIMLQQ-----------YENMaFLKTL 402  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  471 -------------------------------------------------DEDEPSFQEFd---------IDYND-ALQLF 491  Tetrahymena thermophila SB210...
Q43540                         242 --------ASNQL------------------------------------RTNNSSHRSL----------VTTSHeTVECM 267  trumpet lily...
Q8L7T5                         274 --------SSSMFNSY----------------------------------RGQHMFESP----------VPVSPeTIGAM 301  thale cress...
Q4STI5                         298 --------DGV---------------------------------------MDAQGFEKS----------YTVNSsILLAI 320  spotted green pufferfish...
Q9UPN7                         284 --------ESVTVNSFFSsvd-------------------------gqlELLAQGALES----------TVSSVgALHAL 320  human...
Q6PCI0                         284 --------ELGGMSGFYCnld-------------------------gqlEINAAGLDSTsn------tqASLG--TLLAI 322  African clawed frog...
Q922D4                         284 --------EGHI-------------------------------------EICPPGMSHSa---------CSVNKsVLEAI 309  house mouse...
Q4RZH1                         285 --------EGHM--------------------------------------ECPPGISHPs---------FSVNHsILEAV 309  spotted green pufferfish...
KIS68733                       598 SERLSDFQQLVNEprerdaTIPTSVGN--VAPLTFERYRITELYAELLHCSNMALLNRAPGEGpqysddgvltggleglq 675  Ustilago maydis 521...
Q22CQ3                         403 SSSFDALADILAGkd------snAAGGnsRAVLGIHRLKIIEIMNQVIRIQFPSVQEG---------------------- 454  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  492 STYIKATIDYLKNyqq-deTIKTVYRQe-LKPLGQSRLKIVEIYCVALKQSNFYVVQE---------------------- 547  Tetrahymena thermophila SB210...
Q43540                         268 LESLGNLLELLDIsss-gdSLPTTYGSl-KPPLGRYRVKIVEFISVLLRIGSEVAEKK---------------------- 323  trumpet lily...
Q8L7T5                         302 LPKLNDLLMLLTVasd-stVLPTTYGEl-RPPLGKHRLKIVEFIAVLLKTRSEAAQKE---------------------- 357  thale cress...
Q4STI5                         321 QPHLIHFHQLLLQppk-rnPMLTTLGVl-EEPFGNTRLHVARLVASLLYTSSS--SHAVIAQE----------------- 379  spotted green pufferfish...
Q9UPN7                         321 RPRLSCFHQLLLEppk-lePLQMTWGMl-APPLGNTRLHVVKLLASALSANDAALTHE---------------------- 376  human...
Q6PCI0                         323 KEHLHQFHQLLIDppk-kqSLQATWGVl-DPPLGNTRLHVVKLLASIINANNNVLNQE---------------------- 378  African clawed frog...
Q922D4                         310 RGRLGSFHELLLEppk-ksVMKTTWGIl-DPPVGNTRLNVIRLISSLLQTNTSSINGD---------------------- 365  house mouse...
Q4RZH1                         310 RPRLKDFHQLLLDpp----------------------------------------------------------------- 324  spotted green pufferfish...
KIS68733                       676 tlartlqggdgpevgdtsasaeaeamqdiggqqdaapkteaaasedtidtdssvahrvsghardqsstgastdstdeadd 755  Ustilago maydis 521...
Q22CQ3                             -------------------------------------------------------------------------------- Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A      -------------------------------------------------------------------------------- Tetrahymena thermophila SB210...
Q43540                             -------------------------------------------------------------------------------- trumpet lily...
Q8L7T5                             -------------------------------------------------------------------------------- thale cress...
Q4STI5                             -------------------------------------------------------------------------------- spotted green pufferfish...
Q9UPN7                             -------------------------------------------------------------------------------- human...
Q6PCI0                             -------------------------------------------------------------------------------- African clawed frog...
Q922D4                             -------------------------------------------------------------------------------- house mouse...
Q4RZH1                             -------------------------------------------------------------------------------- spotted green pufferfish...
KIS68733                       756 eallnevslydkasapvegssslevpsgsqetdsydesprvttsdsveedqddaasirsalsglslaeltapklsgppsp 835  Ustilago maydis 521...
Q22CQ3                             -------------------------------------------------------------------------------- Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A      -------------------------------------------------------------------------------- Tetrahymena thermophila SB210...
Q43540                             -------------------------------------------------------------------------------- trumpet lily...
Q8L7T5                             -------------------------------------------------------------------------------- thale cress...
Q4STI5                             -------------------------------------------------------------------------------- spotted green pufferfish...
Q9UPN7                             -------------------------------------------------------------------------------- human...
Q6PCI0                             -------------------------------------------------------------------------------- African clawed frog...
Q922D4                             -------------------------------------------------------------------------------- house mouse...
Q4RZH1                             -------------------------------------------------------------------------------- spotted green pufferfish...
KIS68733                       836 ideakdyvvgdmlkrkFLECGILPSLLNLFFDYPWNNFLHNVVYDILQQCF------------NGRMDv----------- 892  Ustilago maydis 521...
Q22CQ3                         455 ----------------LVNSKILQHMLDLFFKYEWHNILHQIVLNILLFII-------------QNCDk----------- 494  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  548 ----------------MAQHNLHAVLLELFLKYEWNNMLHTLVERVIIQ--------------SAQIN------------ 585  Tetrahymena thermophila SB210...
Q43540                         324 ----------------LLHLKAIKHVLDLFFEYPFNNVLHRHVVEIVVSCLd---------------------------- 359  trumpet lily...
Q8L7T5                         358 ----------------LVSSGTIKRTLDLFFEYPYNNALHHQVESIILSCL------------ENKSD------------ 397  thale cress...
Q4STI5                         380 ----------------LCRLNTMDLLLDLFFKYTWNNFLHLQVELCVAAIVrpcahemrlppgSGSQEkphldasqeqss 443  spotted green pufferfish...
Q9UPN7                         377 ----------------LLALDVPNTMLDLFFHYVFNNFLHAQVEGCVSTMLs-----------LGPPPdss-------pe 422  human...
Q6PCI0                         379 ----------------LIELDTLNTMLDLYFQYMYNNFLHAQVEVCITTILn-----------SSPLEeti-------ed 424  African clawed frog...
Q922D4                         366 ----------------LMELNSIGVILDMFFKYTWNNFLHTQVEICIALIL------------ASPFEnaengt-itdqd 416  house mouse...
Q4RZH1                         325 --------------------------kDMYFRYIWNNFLHIQVEICTAMIL------------AMPPApadiqs-dteqe 365  spotted green pufferfish...
KIS68733                       893 -GLNRKLTVAVFEQGCLTSRIVE-GRKRNEdsva---------gprRIRLGYMGH-MNLIAEETVKLLQRYPLEIA-RPV 959  Ustilago maydis 521...
Q22CQ3                         495 -SKIRAYLKHLLVDQNFTQQMISyVGDTLYyfdka------kypdrCTTKGNLGY-IIKIADEIEKFYQKSVQNRQnSDM 566  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  586 ---SHAMRKAVFTDAKLINFLLE-ATKQVDsdiasd-----aptkvNFRKGYLGH-VTKIANFVQRLCENN------AEI 649  Tetrahymena thermophila SB210...
Q43540                         360 -SKNTKLTEHLFFECDILGRILE-AEKQPTlssdcnkptvstpgksPPRKGNFGH-LTQIANKIVELADKN------SFI 430  trumpet lily...
Q8L7T5                         398 -----LMVNHILRDCDLIGKFLL-SDRDSNllgdsqpt-vaasgkkKPRVGYVGH-ITRISNKIGQLSNSN------GQI 463  thale cress...
Q4STI5                         444 sELPPNLCSALFQQCRLVPRILD-AWEENDriq----------sagGMRRGYMGH-LTRIANTVVHNLEKGPVHAQiSSL 511  spotted green pufferfish...
Q9UPN7                         423 tPIQNPVVKHLLQQCRLVERILT-SWEENDrvq----------cagGPRKGYMGH-LTRVAGALVQNTEKGPNAEQlRQL 490  human...
Q6PCI0                         425 eAQGSPLVRYLLQKCHLVQRILS-AWEENDkeq----------segGRRRGFMGH-LTKIANSVVQSSEKGPNVSLvGQL 492  African clawed frog...
Q922D4                         417 sTGDNLLLKHLFQKCQLIERILE-AWDTNEkkq----------aegGRRHGYMGH-LTRIANCIVHSTDKGPNSALvQQL 484  house mouse...
Q4RZH1                         366 hSRESILISHV-NTHHIQSASDDeVDFKDSgfh----------qdsSLQQAFSDYqMQQMTSNFIEQFGFNDEEFAd--- 431  spotted green pufferfish...
KIS68733                       960 EVFT---ERDEWRQVVSETLE-EIREKEGG 985  Ustilago maydis 521
Q22CQ3                         567 LDW----HNQEWINFMEITLD-IHKERGCK 591  Tetrahymena thermophila SB210
WGS:AAGF:cds.TTHERM_00190658A  650 QEYV---DHDLWGQLRDSYLD-QTNQNNNR 675  Tetrahymena thermophila SB210
Q43540                         431 QTRLk--ENKEWSDWQNSVLF-ERNKLENV 457  trumpet lily
Q8L7T5                         464 KAYLq--ENSEWNEWQGSVLQ-DRNTVENV 490  thale cress
Q4STI5                         512 ISELpedCRGRWEAFVDQTLS-EANRKNAI 540  spotted green pufferfish
Q9UPN7                         491 LKELpseQQEQWEAFVSGPLA-ETNKKNMV 519  human
Q6PCI0                         493 IKDLtdeEQEHWDGFVTGSLT-ETNKKNTI 521  African clawed frog
Q922D4                         485 IKDLpdeVRERWETFCTNSLG-ETNKRNTV 513  house mouse
Q4RZH1                         432 QDDV---VDIPFDRISDINFSlNTNESANI 458  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap