1L8D


Conserved Protein Domain Family
Rad50_zn_hook

?
pfam04423: Rad50_zn_hook 
Click on image for an interactive view with Cn3D
Rad50 zinc hook motif
The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.
Statistics
?
Aligned: 57 rows
Threshold Bit Score: 37.5155
Threshold Setting Gi: 18203646
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1L8D_A             29 LKNKIGDLKTAIEELKKAKG--KCPVCGRELTDEHREELLSKYHLDLNNSK 77   Pyrococcus furiosus
jgi:Tsac_1852     408 fNKKTEELKENYKAILQTDA--KCPLCNSPLDENKKSNLLNDIKKEINDIA 456  Thermoanaerobacterium saccharolyticum ...
Q58718            481 INSEIKRLKKILDELKEVEG--KCPLCKTPIDENKKMELINQHKTQLNNKY 529  Methanocaldococcus jannaschii DSM 2661
jgi:Maeo_0711     476 NNAEINQTKDAIEKLKGTTEd-KCPVCQSNIDGLKKQELLKQYNQLIEERK 525  Methanococcus aeolicus Nankai-3
wustl:Msm_0120    448 fKQAIETAQKPLDELGDVEN--KCPVCQSDINPQKKNELIDSYNNEIKINE 496  Methanobrevibacter smithii ATCC 35061
Q9HLR8            435 LRQKEEEIRRNMNMLEGHN---KCPVCGTDLGDEGSRRIREHYSEDLNRLN 482  Thermoplasma acidophilum DSM 1728
Q9YFZ1            441 LEAEARRLVQALSMLEESGGsaRCPVCGAELPPGRAEAIARHYRHEAERLR 491  Aeropyrum pernix K1
jgi:Pse7367_1925  477 cqaQFSELSDRLAQLSQPHQa-DCPLCQQSLDHNHREQLKQKLEQEYQSLQ 526  Pseudanabaena sp. PCC 7367
Q7NCW4            477 yrKELDQLAEKAALLAQGET--DCPLCGGPLDAEHRELLGEQHQRQHAELE 525  Gloeobacter violaceus
jgi:Msed_0762     398 RKVEYDQIRKSLDALLSATEg-KCPVCGGPLDEPHRQELTQKYRQRLTELS 447  Metallosphaera sedula DSM 5348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap