Conserved Protein Domain Family
HemX

?
pfam04375: HemX 
HemX, putative uroporphyrinogen-III C-methyltransferase
This is a family of bacterial putative uroporphyrinogen-III C-methyltransferase proteins. It forms one of the members of a complex of proteins involved in the biogenesis of the inner membrane in E.coli. Uroporphorphyrin-III C-methyltransferase (HemX) is a single spanning inner membrane protein that regulates the activity of NAD(P)H:glutamyl-tRNA reductase (HemA) in the tetrapyrrole biosynthesis pathway.
Statistics
?
PSSM-Id: 335754
View PSSM: pfam04375
Aligned: 25 rows
Threshold Bit Score: 248.377
Threshold Setting Gi: 81358363
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9CK22        96 KGGGTGLALLALLVALG-LGAA---GYYFGLQQV-----------DHIQHKLSALEQQTTNitpakvdl-----ptfeqe 155 Pasteurella mul...
Q6LLM7        95 KKSGSKTGAIAIALVIA-LGAG---LYYHGHQQSlaqe----aqiAALQQQIANISNQVQT------------------- 147 Photobacterium ...
Q5P7H8        34 SKRGGGVATAVALVALA--------AAGLAAWQVyelrsgaieirEEVAQRLAASDSALAEarg---------------s 90  Aromatoleum aro...
Q9HTT7        29 SGTATGLALLALLVGVAgLGAGgwsFWQVQQLQ------------GTERDQLAQLEDARGKtes---------------l 81  Pseudomonas aer...
Q4K3X5        27 eRRGNGLAILALLLGAAgVAVGgwgIWQVRHLQ------------ANNQQQFSQLQALGDQaqs---------------l 79  Pseudomonas pro...
Q88B89        33 GNRSSGLVFLALLLGIAgIAVAgwgVWQLRMLQ------------AGHQQQRGQVEDIAEQtlv---------------l 85  Pseudomonas syr...
ERS04748       4 V------AVLALILAIA-LG-----LWNWQQWQKhqat---lqvvQDLRQDTNQLESLYGN------------------- 49  Marinobacter sp...
WP_004724348  67 GKRGVKLGTIAIVLAVL-FGGG---LTLHSQQQQadyqaqiqalrAELEQTRSNINAQLDA------------------- 123 Vibrio furnissii
WP_015432258  77 RSGGTGIALLALLVALG-VGGA---GYFLGNQKF-----------VELDGQIKTLGQKVAQmpqtvmqspeieipsfeae 141 Bibersteinia tr...
WP_015939563  78 SSGGKALSLLAILIALG-VGAT---GYFFGNQKF-----------AQLDTQIQALQAKATQnhpeqtvae---tpnfdee 139 Haemophilus par...
Q9CK22       156 rqQIAQlmrSIRDN--EEKLQQLEKELAGKDHSLSALQNQVNRMSAAakqqQPNDWLLSEADFLLNNALRKLVLDNDVDT 233 Pasteurella mul...
Q6LLM7       148 --SQKE---TIGQV--DQSLQRTQVVIEQQDKSISSLQLALSEMEGR----RPNDWLLAEADYLIKMAGRKLWLEHDVIS 216 Photobacterium ...
Q5P7H8        91 arQQQEsiaSLQGK--IGALEAHVAATEGQAAALENLYQEFSR--------TRDDRIVAETEQAIGIAAQQLQLAGNPEA 160 Aromatoleum aro...
Q9HTT7        82 aqRNQQlaaRLDALptADELEARRRLVVELQGDQQHLSEQLKKVLGQ----SRQQWRLAEAEHLLRLASLRLSALQDVGS 157 Pseudomonas aer...
Q4K3X5        80 klSEQRlseRLEQLpaADELEDRRRLVAQLQGDQQRLNQRLETVLGA----SRKDWRLAEAEHLLRLASLRLSALQDISS 155 Pseudomonas pro...
Q88B89        86 aqNDQQlsaRLAQLppANQLEDSRRLVAQLQGDQQRLSQRLETVLGA----SRKDWRLAEAEHLLRLASLRLSALQDINS 161 Pseudomonas syr...
ERS04748      50 --RGSEqseRLQAL--ENRVAEQRELIATQQRQIDHTARELLEAGNR----TRTDWLLAEAEYLLRIANQRLLIEKDIRG 121 Marinobacter sp...
WP_004724348 124 --TKQD---AVDKA--TELTHRAEVVLTQQQKSIESLQLAVADIKGR----RPNDWLLAEADYLVKLAGRKLFLEHDVDS 192 Vibrio furnissii
WP_015432258 142 ktQIAQlahAYQQA--NSRVEQLEKEQNAYTQQINALQQQVQRLGANpv-aEPTAWLFSDADFLLNNALRKMALDNDIDT 218 Bibersteinia tr...
WP_015939563 140 kvKIAKltqDYQQS--LDKIAQLENAQTAYTQQINALQSQIQKLGATpk-aDQSEWLLSDADFLLNNALRKVVLDNDIDT 216 Haemophilus par...
Q9CK22       234 GVSLLKIADETLEKMSDPRVSMVRTAINNDLKQLLAVNNVDQNVIMQRLSQLANTIDEL---TVLDVNFDA----VNNNE 306 Pasteurella mul...
Q6LLM7       217 STTLLESADHRIAELNDPSLRNVRKAMSNDITSLKAVARIDRDGLVLRLTSLQEQVATL---PLANAIIPEae-aVEENA 292 Photobacterium ...
Q5P7H8       161 ALIALQGAEARLAAQDRGQFQALRRALVRDIERLQTAPQVDVPGIALRLEMLLERVDTL---PLAFAGQLDdp-aAARNA 236 Aromatoleum aro...
Q9HTT7       158 ATELVQGADDILRAQNDPGAYAARAKLAASLEALRALPEPDRTGLFVQLAALREQVNQL---QPLTPTFKEge-sGASNV 233 Pseudomonas aer...
Q4K3X5       156 ARALVQGADDILREQNDPGAFAAREQLAKSLAALRSTEQPDRTGLFLQLGALRDQVLEL---SAVAPEYKDrgesLLGLT 232 Pseudomonas pro...
Q88B89       162 AQALVQGADEILREQDDPGSFAAREQLAKSLAALRSVEQPDRTGLFLQLGALREQAVQL---NKLAPEYEDkgesLLGLT 238 Pseudomonas syr...
ERS04748     122 SLSALESADEVLRESDDIGVYPVRQQLAREIQSLRGIQGVDRTGLYLRLEAAIASVNDLtdqALISDQAPGfd-mVEDQN 200 Marinobacter sp...
WP_004724348 193 ATLLMESADQRIAALNDPSLTPLRKAMANDITTLKAIPRLDRDGLVLRLTSLQQQVDTL---PLANAILPDap-qETEQA 268 Vibrio furnissii
WP_015432258 219 ARSLLIEADNVLSQVSDPKALAIRNAIKTDLNTLDSVNEIDQNTLMQRLARLANLVDNL---PMADSGESE----KADNG 291 Bibersteinia tr...
WP_015939563 217 ARSLLIEADNVLSQVGDNRVLNIREAIKQDLSQLASVNNVDQNNLMQRLTQLANLLDDM---PMIDNTVEEe---SVATG 290 Haemophilus par...
Q9CK22       307 kLTD--------SLDDWKENAEKSATSFLNHFIRITPRN--TSDKVLLAPNQDIYLRENIRLRLQIAIMAVPRQQDELYK 376 Pasteurella mul...
Q6LLM7       293 -VST--------SVDDWQINLKTSLKNFSEHFVTYRQRD--GSVIPLLSPKQDFYLQENIKSKLETAIHSVYREQGKVYA 361 Photobacterium ...
Q5P7H8       237 gASApegastepSVIDFITGLARDIWREMLTLVRIERLD--QSEPVLLAPAQSTYLRENLKIRLLTARLALLARDGRTFA 314 Aromatoleum aro...
Q9HTT7       234 aWGD--------GNSTWELWWEK-----ISRYIRIDFNAg-QDIRPLLAGEQLAQVRLTIGLALEQAQWAALNGKQEVYE 299 Pseudomonas aer...
Q4K3X5       233 aDGD--------GASRWAQWWDQ-----ISRYFRIDFNAd-KNIRPLLAGQGLTQVRLALSLALEQAQWAALNGQAAVYT 298 Pseudomonas pro...
Q88B89       239 aDNT--------EQSRWSQWWDE-----ISHYFRVDFNAn-KDIRPVLAGQSLAQVRLALSLALEQAQWAALNGEPQVYS 304 Pseudomonas syr...
ERS04748     201 aPSDgs----nmFTRGWNRFLGT-----LKEVVVIRRMD--EPVKPLLSPDQSAWARLNLQLMLEEAEMAVLRGNQPLYE 269 Marinobacter sp...
WP_004724348 269 -VSE--------NINNWQQNLMTSLKDFANNFITFRTRD--GNVVPLLSPQQHFYLKENLKAKLETAIKSVYTEQQEIYT 337 Vibrio furnissii
WP_015432258 292 eVSD--------SIDDWQKNIEKSADSFLSHFIRINDKGrvVNDKAFIAPNQEIYLRENIRLRLQIAILAVPRQQNELYK 363 Bibersteinia tr...
WP_015939563 291 eVSN--------SVQDWQQNLEKSANSFLNHFIRISDKAt-AKEKAFVAPNQEIYLRENIRLRLQIAILAIPRQQNELYK 361 Haemophilus par...
Q9CK22       377 QSLETVASWIRSYFDTNSEVAQNFLKTLDELAEQSIYVDVPSQLQSLNALDKLLDRPSQDV 437 Pasteurella multocida
Q6LLM7       362 TSLTMAKQWAEQFYNLDNPATQSFINTLDQLAKENIEASYPDRLQSQPIISDLINERLRGK 422 Photobacterium profundum
Q5P7H8       315 ADLAQAQGWIERFFDQRDPAVQETLAELAALQALPVKVEQPTPTESLGALRMLQARSAESR 375 Aromatoleum aromaticum EbN1
Q9HTT7       300 QALKQAQDVLDGYFNVELADSRALKLRIDELAKQPVTVQVPDLAPALSALQAYVSRREAAG 360 Pseudomonas aeruginosa
Q4K3X5       299 QALTEARDVLTGNFNQDNPQSKIMLERLAELSKQPVTVVTPDLAKTLSTVQAYLERRNLNV 359 Pseudomonas protegens Pf-5
Q88B89       305 QAITEAQNVLKANFNQDDPQSKVLGQGLEALASKPVSVKTPDLAPTLSSVQAYLERRHAAG 365 Pseudomonas syringae pv. tomato
ERS04748     270 RALNKAITTINDWYDGTNPAIRGLNETLNELAERNVDPELPDISQSLSLLKERLAGRLATG 330 Marinobacter sp. EN3
WP_004724348 338 VSLTTADQWSKSFFNQSDNRVKAFNQTLEQLAKQQVQVEYPVKLGTQKQLADVITDRLRRS 398 Vibrio furnissii
WP_015432258 364 QSLEAVSTWVRSYFDLQNADVQTFLKELDSVGEQSIYVDAPHKLQSLELLERNLNKASKPI 424 Bibersteinia trehalosi
WP_015939563 362 QSLEAVSTWVRSYFDVQNEQVKTFLKEIDEMIEQSIYIDAPNRLHSLGLLDQLLNKAPKPI 422 Haemophilus parasuis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap