Conserved Protein Domain Family
HemX

?
pfam04375: HemX 
HemX, putative uroporphyrinogen-III C-methyltransferase
This is a family of bacterial putative uroporphyrinogen-III C-methyltransferase proteins. It forms one of the members of a complex of proteins involved in the biogenesis of the inner membrane in E.coli. Uroporphorphyrin-III C-methyltransferase (HemX) is a single spanning inner membrane protein that regulates the activity of NAD(P)H:glutamyl-tRNA reductase (HemA) in the tetrapyrrole biosynthesis pathway.
Statistics
?
Aligned: 24 rows
Threshold Bit Score: 249.533
Threshold Setting Gi: 81358363
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
VBC:UMN179_02213    105 SGGGKGLALLALLVALG-VGAG---GYYLGQQQL-----------SNLQQQVAALESSQQAvtkaassnsv-dmsevnal 168 Gallibac...
ACL32623             78 SSGGKALSLLAILIALG-VGAT---GYFFGNQKF-----------AQLDTQIQALQAKATQnhpeqtvae---tpnfdee 139 Glaesser...
USMARC:WQG_8430      77 RSGGTGIALLALLVALG-VGGA---GYFLGNQKF-----------VELDGQIKTLGQKVAQmpqtvmqspeieipsfeae 141 Biberste...
Q6LLM7               95 KKSGSKTGAIAIALVIA-LGAG---LYYHGHQQSlaqe----aqiAALQQQIANISNQVQT------------------- 147 Photobac...
JLExeter:vfu_A00431  67 GKRGVKLGTIAIVLAVL-FGGG---LTLHSQQQQadyqaqiqalrAELEQTRSNINAQLDA------------------- 123 Vibrio f...
Q5P7H8               34 SKRGGGVATAVALVALA--------AAGLAAWQVyelrsgaieirEEVAQRLAASDSALAEarg---------------s 90  Aromatol...
CCU74056             30 ahplSWINLVLMLVLIA-IMGF---AVWLGWQQQqsttaevavlrDHLNTALQTLDQTSAR------------------- 86  Thalasso...
jgi:Maqu_0485        28 V------AVLALILAIA-LG-----LWNWQQWQKhqat---lqvvQDLRQDTNQLESLYGN------------------- 73  Marinoba...
Q9HTT7               29 SGTATGLALLALLVGVAgLGAGgwsFWQVQQLQ------------GTERDQLAQLEDARGKtes---------------l 81  Pseudomo...
Q4K3X5               27 eRRGNGLAILALLLGAAgVAVGgwgIWQVRHLQ------------ANNQQQFSQLQALGDQaqs---------------l 79  Pseudomo...
VBC:UMN179_02213    169 keALTKTEQELNAT--KSTLEVLQQNKGITEQQIIALQTQLNKTMAEksqaQPNEWLMSEADFLLSNAQRKLIIDNDLGT 246 Gallibac...
ACL32623            140 kvKIAKLTQDYQQS--LDKIAQLENAQTAYTQQINALQSQIQKLGATpk-aDQSEWLLSDADFLLNNALRKVVLDNDIDT 216 Glaesser...
USMARC:WQG_8430     142 ktQIAQLAHAYQQA--NSRVEQLEKEQNAYTQQINALQQQVQRLGANpv-aEPTAWLFSDADFLLNNALRKMALDNDIDT 218 Biberste...
Q6LLM7              148 --SQKE---TIGQV--DQSLQRTQVVIEQQDKSISSLQLALSEMEGR----RPNDWLLAEADYLIKMAGRKLWLEHDVIS 216 Photobac...
JLExeter:vfu_A00431 124 --TKQD---AVDKA--TELTHRAEVVLTQQQKSIESLQLAVADIKGR----RPNDWLLAEADYLVKLAGRKLFLEHDVDS 192 Vibrio f...
Q5P7H8               91 arQQQESIASLQGK--IGALEAHVAATEGQAAALENLYQEFSR--------TRDDRIVAETEQAIGIAAQQLQLAGNPEA 160 Aromatol...
CCU74056             87 ----------ENDL--MGRAESLAKSSQQLQEQVAHNTDRLGKLPGA----ERQDWLLAEAEYLLRLANQRLQLERDWDG 150 Thalasso...
jgi:Maqu_0485        74 --RGSEQSERLQAL--ENRVAEQRELIATQQRQIDHTARELLEAGNR----TRTDWLLAEAEYLLRIANQRLLIEKDIRG 145 Marinoba...
Q9HTT7               82 aqRNQQLAARLDALptADELEARRRLVVELQGDQQHLSEQLKKVLGQ----SRQQWRLAEAEHLLRLASLRLSALQDVGS 157 Pseudomo...
Q4K3X5               80 klSEQRLSERLEQLpaADELEDRRRLVAQLQGDQQRLNQRLETVLGA----SRKDWRLAEAEHLLRLASLRLSALQDISS 155 Pseudomo...
VBC:UMN179_02213    247 AISLLKEADLVLNDVTDPRAITVRTAIAQDLKRLANVNDVDQNAIMQKLSQLANSVDDL---ELLDLSANN--SDSENSD 321 Gallibac...
ACL32623            217 ARSLLIEADNVLSQVGDNRVLNIREAIKQDLSQLASVNNVDQNNLMQRLTQLANLLDDM---PMIDNTVEE---ESVATG 290 Glaesser...
USMARC:WQG_8430     219 ARSLLIEADNVLSQVSDPKALAIRNAIKTDLNTLDSVNEIDQNTLMQRLARLANLVDNL---PMADSGESE----KADNG 291 Biberste...
Q6LLM7              217 STTLLESADHRIAELNDPSLRNVRKAMSNDITSLKAVARIDRDGLVLRLTSLQEQVATL---PLANAIIPEa-EAVEENA 292 Photobac...
JLExeter:vfu_A00431 193 ATLLMESADQRIAALNDPSLTPLRKAMANDITTLKAIPRLDRDGLVLRLTSLQQQVDTL---PLANAILPDa-PQETEQA 268 Vibrio f...
Q5P7H8              161 ALIALQGAEARLAAQDRGQFQALRRALVRDIERLQTAPQVDVPGIALRLEMLLERVDTL---PLAFAGQLDd-PAAARNA 236 Aromatol...
CCU74056            151 ALSMLSAADNVLLETRNPRMDKVRALIAREILALRAVPAIDRVGAILRIQALQEQVTSL---PWMPEKLIAe-PQTQDVA 226 Thalasso...
jgi:Maqu_0485       146 SLSALESADEVLRESDDIGVYPVRQQLAREIQSLRGIQGVDRTGLYLRLEAAIASVNDLtdqALISDQAPGf-DMVEDQN 224 Marinoba...
Q9HTT7              158 ATELVQGADDILRAQNDPGAYAARAKLAASLEALRALPEPDRTGLFVQLAALREQVNQL---QPLTPTFKEg-ESGASNV 233 Pseudomo...
Q4K3X5              156 ARALVQGADDILREQNDPGAFAAREQLAKSLAALRSTEQPDRTGLFLQLGALRDQVLEL---SAVAPEYKDrgESLLGLT 232 Pseudomo...
VBC:UMN179_02213    322 DPSD--------SISDWKSNIEKSANSFLNHFIRIQPRD--PVEKALLAPNQDIYLRENIRLRLQIAILAVPRQQNELYK 391 Gallibac...
ACL32623            291 EVSN--------SVQDWQQNLEKSANSFLNHFIRISDKAt-AKEKAFVAPNQEIYLRENIRLRLQIAILAIPRQQNELYK 361 Glaesser...
USMARC:WQG_8430     292 EVSD--------SIDDWQKNIEKSADSFLSHFIRINDKGrvVNDKAFIAPNQEIYLRENIRLRLQIAILAVPRQQNELYK 363 Biberste...
Q6LLM7              293 -VST--------SVDDWQINLKTSLKNFSEHFVTYRQRD--GSVIPLLSPKQDFYLQENIKSKLETAIHSVYREQGKVYA 361 Photobac...
JLExeter:vfu_A00431 269 -VSE--------NINNWQQNLMTSLKDFANNFITFRTRD--GNVVPLLSPQQHFYLKENLKAKLETAIKSVYTEQQEIYT 337 Vibrio f...
Q5P7H8              237 GASApegastepSVIDFITGLARDIWREMLTLVRIERLD--QSEPVLLAPAQSTYLRENLKIRLLTARLALLARDGRTFA 314 Aromatol...
CCU74056            227 PIPL--------EEQTWYWNAWRYVKDNVTRMVRIRERT--APIAAPLTPDQQYYLQQNMRLMLEQAQVALLREQTDLYQ 296 Thalasso...
jgi:Maqu_0485       225 APSDgs----nmFTRGWNRFLGT-----LKEVVVIRRMD--EPVKPLLSPDQSAWARLNLQLMLEEAEMAVLRGNQPLYE 293 Marinoba...
Q9HTT7              234 AWGD--------GNSTWELWWEK-----ISRYIRIDFNAg-QDIRPLLAGEQLAQVRLTIGLALEQAQWAALNGKQEVYE 299 Pseudomo...
Q4K3X5              233 ADGD--------GASRWAQWWDQ-----ISRYFRIDFNAd-KNIRPLLAGQGLTQVRLALSLALEQAQWAALNGQAAVYT 298 Pseudomo...
VBC:UMN179_02213    392 SSLEVVTSWVRSYFNVDSALAQKFLQQLDELSEQSIYVDAPNTFESLTVLDEILHKQPHQI 452 Gallibacterium anatis UMN179
ACL32623            362 QSLEAVSTWVRSYFDVQNEQVKTFLKEIDEMIEQSIYIDAPNRLHSLGLLDQLLNKAPKPI 422 Glaesserella parasuis SH0165
USMARC:WQG_8430     364 QSLEAVSTWVRSYFDLQNADVQTFLKELDSVGEQSIYVDAPHKLQSLELLERNLNKASKPI 424 Bibersteinia trehalosi USDA...
Q6LLM7              362 TSLTMAKQWAEQFYNLDNPATQSFINTLDQLAKENIEASYPDRLQSQPIISDLINERLRGK 422 Photobacterium profundum
JLExeter:vfu_A00431 338 VSLTTADQWSKSFFNQSDNRVKAFNQTLEQLAKQQVQVEYPVKLGTQKQLADVITDRLRRS 398 Vibrio furnissii NCTC 11218
Q5P7H8              315 ADLAQAQGWIERFFDQRDPAVQETLAELAALQALPVKVEQPTPTESLGALRMLQARSAESR 375 Aromatoleum aromaticum EbN1
CCU74056            297 HSLKRVHQWLDEYLMMSDERTRAAYAALTELQAWNAAPARPDISASLLELQTLVEQQRRGT 357 Thalassolituus oleivorans M...
jgi:Maqu_0485       294 RALNKAITTINDWYDGTNPAIRGLNETLNELAERNVDPELPDISQSLSLLKERLAGRLATG 354 Marinobacter hydrocarbonocl...
Q9HTT7              300 QALKQAQDVLDGYFNVELADSRALKLRIDELAKQPVTVQVPDLAPALSALQAYVSRREAAG 360 Pseudomonas aeruginosa
Q4K3X5              299 QALTEARDVLTGNFNQDNPQSKIMLERLAELSKQPVTVVTPDLAKTLSTVQAYLERRNLNV 359 Pseudomonas protegens Pf-5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap