Conserved Protein Domain Family
FemAB_like

?
pfam04339: FemAB_like 
Peptidogalycan biosysnthesis/recognition
FemAB_like is a family of both baterial and Viridiplantae proteins with responsibility for building interpeptide bridges in peptidoglycan. Such a function is feasible for bacteria but less likely for the plant members of this family. Perhaps the plant-members are using homologous proteins to recognize bacterial peptidoglcans as part of their innate immune system.
Statistics
?
PSSM-Id: 309466
View PSSM: pfam04339
Aligned: 77 rows
Threshold Bit Score: 500.87
Threshold Setting Gi: 501046505
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1QKK7        13 SVSQITAVDWDACanpATkqhrslasdeapasssaqdSclsareqynPFVSHAFFTALEASNSACPRTGWRPRHLIARLD 92  Nitrobacter ham...
Q31P02        12 RLGDLPREDWNAI---AQp------------------La-------tPFLEWDWLHDLEASGSVIAKAGWQPCHLVVWRG 63  Synechococcus e...
Q7V3H1        13 SIQEINKETWNEL---RKe------------------In-------nPFYEWEWLYNLELSKSVSRQTGWQPLYFIAYEN 64  Prochlorococcus...
Q7VE88        12 SIKEIPREKWAHL---VNk------------------Kv-------lPFYDWNWLNALEESESVSSRYGWQPLHLSLWEN 63  Prochlorococcus...
Q8DHT3        19 AIASVPQNQWDAL---ALp------------------Le-------tPFFEWEWLHQIEASGSATPQTGWLPHHLLVWRD 70  Synechococcus e...
Q10W29        16 KIAEVPKPEWDAL---AQp------------------Lk-------tPFLEWDWLHNMEKSGSVGGRSGWLPQHLTVWRD 67  Trichodesmium e...
P74568        16 ALAEIPQPQWDRL---AVp------------------Lq-------tPFLEWHWLNNLETSGSAVRNTGWQPCHLTVWQG 67  Synechocystis s...
Q7NE42        13 SLQSIDPHEWNTL---VG-------------------Dg-------sPFLEWEWLRSMELAGCVSPGEGWQPVHLVARRG 63  Gloeobacter vio...
WP_009547674  16 kISEIPKQVWDEL---ATp------------------Lk-------tPFLEWEWLNNIETSKSATPRTGWQPCHLTLWRD 67  Cyanothece
WP_006196374  16 KIAEVPQNAWDAL---AMp------------------Lk-------tPFLEWDWLNNLEISQSATAKTGWLPNHLTLWRD 67  Nodularia spumi...
Q1QKK7        93 G----AVVGVVPCYLKSHSQGEYVFDHGWAQAYESAGGRYYPKLLASVPFTPATGPRLLIRAGSDKARVGAALVGGLVGL 168 Nitrobacter ham...
Q31P02        64 D----RLVAAAPLYLKGHSYGEFVFDQQWADLAGRLGLRYYPKLLGMTPLTPAVGYRFLIAPAEDEATLTGLMLREIDRF 139 Synechococcus e...
Q7V3H1        65 E----EICGIAPLFLKNHSYGEFIFDQSFAKLAQDLNLNYYPKLIGMSPYSPISGYEFLYKENKNKIEITNSLIKHIDDF 140 Prochlorococcus...
Q7VE88        64 N----RLISLAPLYLKNHSYGEFIFDQAFANLSNRLSVPYYPKLIGMSPLSPIEGYKFFISSEKDSREITEVMMKIIDEF 139 Prochlorococcus...
Q8DHT3        71 RqgqrELVAAAPLYVKGHSQGEFVFDHQWADLAARLGIRYYPKLLGMAPFTPAVGYRFLMVEGVDVAMMTKVMLHEIDRL 150 Synechococcus e...
Q10W29        68 R----QLIAAAPLYLKGHSQGEFVFDHQWAEISYRLGIEYYPKLLGMSPFTPAEGYRFLIASGEDEDEITAMMVSEIDYF 143 Trichodesmium e...
P74568        68 E----TLLGAAALYLKGHSYGEFVFDHQWADLAQRLGIDYYPKLLGMAPFTPAEGYRFLIDPEANESLVTQIMVEAIDHF 143 Synechocystis s...
Q7NE42        64 G----RLVGAAPLYLKGHSYGEFVFDHAWADAAGRMGLRYYPKLMGVTPFTPAAGYRFLMHPGEEPGALMSGITQAIDTF 139 Gloeobacter vio...
WP_009547674  68 K----QLIAVAPLYIKGHSYGEFVFDHQWADLSHRLGIPYYPKLLGMTPFTPAVGYRFLITPNENEAEITEIMVAAIDHF 143 Cyanothece
WP_006196374  68 R----TLIAVAPLYLKGHSYGEFVFDHQWAELADRIGVQYYPKLLGMTPFTPAEGYRFLIAPGEDEDEITALMVHEIDAF 143 Nodularia spumi...
Q1QKK7       169 CDATQASSVHVTFARQEEWTFLaGNGFLQRTDQQFHWRNEGYSSFEDFLANLASRHRKAIRRERRDALANGITIHVLTGN 248 Nitrobacter ham...
Q31P02       140 CDNNQILSCNFLYVDPDWQPLVeAAGYSAWQHHNSVWQNRGFRTFDDYLGMFNANQRRNIKREVKSMERAGLTLTCLSGD 219 Synechococcus e...
Q7V3H1       141 ALQNNILSCNFLYVNEDWGKHLkSLGYQEWINTSSEWKNNGEKTFDDFLSRFNSNQRKNIKKERKSISKQNLEIKIHTEE 220 Prochlorococcus...
Q7VE88       140 AINNNISSCNFLYVDPSWKKHGeSANCSSWINKQTLWSSHGEQSFEDYLARFNSNQRRNIKKERQSITKTDLRISIINGE 219 Prochlorococcus...
Q8DHT3       151 CQRHRFSSCHFLYVDPQWQPAAeAYGYRAWLHHSYIWQNRNYQTFDDYLADFNANQRRNIKRERKAVAQAGLTFRVHQGD 230 Synechococcus e...
Q10W29       144 CDRHNISGCHFLYVDPEWHPIIkRNGFTNWLHHSYIWQNQGYQTFDDYLKVFNANQRRNIKRERKAVGKAGLQMQTLTGD 223 Trichodesmium e...
P74568       144 CQTNQISGCNFLFVDRQWQKQMeSLGFTSWLHHSYIWQNQNFQDFDDYLQIFNANQRRNIKRERKAVQKAGLRIQVLQGN 223 Synechocystis s...
Q7NE42       140 ARNNRILSASFLYVAPRERERFqAQDCLERITHNYQWVNGGYRDFDEYLQRFNANQRRNIRRERAALEREGLTFTTYTGD 219 Gloeobacter vio...
WP_009547674 144 CDQNKLSGCHFLFVDPDWKPMIeNCGFSSWLHHSYIWSNPNFNNFDDYLKQFNANQRRNIKRERKAVNKANLTMKVLTGD 223 Cyanothece
WP_006196374 144 CIKHRISGCHFLYVDPQWRTVLeRQGFTTWLHHSYIWENVGFKTFDDYLKLFNANQRRNIKRERKAVEKVGLRLQPLTGD 223 Nodularia spumi...
Q1QKK7       249 ELTEETWDAFFQFYMETGSRK--WGRPYLTRSFYSLIGES-MSRDIALIMA--R---RDGRW--IAGAINFIGSDTLFGR 318 Nitrobacter ham...
Q31P02       220 QIPRDYFPLMYRFYSDHCDKFgwWGSKYLTRDFFDRAMHH-SRHRLLFVAAtp---eGSDRP--IAMSFCVHKGDRLYGR 293 Synechococcus e...
Q7V3H1       221 NINLEMVQKMHNFYEQHCLRWgvWGSKYLTSEFFENILEN--KRNLLFFSA--S---RNDSEstIAMSMCIKNEKYIWGR 293 Prochlorococcus...
Q7VE88       220 EINLAMMEMMHNFYEAHCSRWgaWGSKYLTKAFFERLANKdLANNIVLFNA--Nr--GNPKEp-IAMSFCITDYQTLWGR 294 Prochlorococcus...
Q8DHT3       231 EVSRSLLQRMHDFYADTCDKFgwWGSKYLTRQFFEALSDR-YRHRVVLFAAypN---SGGQRp-IAMSFCITKGTNLYGR 305 Synechococcus e...
Q10W29       224 EISKALCSKMYNFYESTCDKFgwWGSKYLTRRFFEQLHHN-FRHRVLFVAGysE---ENDRFp-VGMSFCITKGDRLYGR 298 Trichodesmium e...
P74568       224 QIPHHFFPAIYRFYSNTCDKFy-WGSKYLTKKFFQSLYED-YRARVVLVLAfpE---HDDQHp-VGLSFCLRKGDRLYGR 297 Synechocystis s...
Q7NE42       220 SIRADLFGLMYRLYDDTCSKFm-WSSKYLNRRFFQLIAEC-FAHRTVFIAA--H---KQADI--LAMSFNIRKGNHLYGR 290 Gloeobacter vio...
WP_009547674 224 EIPHHLYPMIYRFYNNTCEKFy-WGSKYLTRKFFEQLYPH-YSHRVVLAAA--YtdyDDHKP--VGLSFCIRKDDNLYGR 297 Cyanothece
WP_006196374 224 AIPQSLFPLMYEFYADTCDKFgwWGSKYLTKQFFEQLHTN-YRHRVVFFPAytE---QDERQp-VGMSFCLFKGDRLYGR 298 Nodularia spumi...
Q1QKK7       319 HWGAIEHHPFLHFEVCYYQAIDFAIRHRLKTVEAGAQGEHKIARGYLPQTTYSAHYIADPALRRAVGDYLKHERHYVAEA 398 Nitrobacter ham...
Q31P02       294 YWGCDHEIDNLHFNVCYYKPIEWAIANGIQSFDPGAGGSHKKRRGFPATPNWSLHRWYQPRFGQILGTWLRQVNELESQE 373 Synechococcus e...
Q7V3H1       294 YWGSQEEVLNLHFELCYYQPIEWAIKNNIESFDPGAGGKHKRRRGFYAKGAKSFHKWFNKNMKNIITPWLNEVNFQTLKE 373 Prochlorococcus...
Q7VE88       295 YWGSKEEIKNLHFELCYYSPISWAIKNGIKEFDPGAGGNQKMRRGFTATPRFSLHRWYDNTMAQIIKDWLPKANNMMKEE 374 Prochlorococcus...
Q8DHT3       306 YWGCAREIDCLHFSACYYEPIEWAIAHGIQRFDPGAGGRHKKRRGFPATPNYSLHRFYEPRLAEIFDHYIDQINDEEQRL 385 Synechococcus e...
Q10W29       299 YWGSNYEIDCLHFDACYYTPIEWAIQNGIKSFDPGAGGRHKKRRGFPATPNHSMHRFYHNRLSKIFLSYIGQVNEMEQLE 378 Trichodesmium e...
P74568       298 YWGSLADYDCLHFEACYYQPIQWAIGENIQLFDPGAGGRHKRRRGFPATANYSLHRFYHPKMQQILQIYIDEINAMEQAE 377 Synechocystis s...
Q7NE42       291 YWGCTEEVKFLHFSTCYYQPVEAAIEMGLKVFDPGAGGQFKMRRGFAATPNYSLHRIYHPRFRQILEDHLKQANRATLEG 370 Gloeobacter vio...
WP_009547674 298 YWGSFEEYDCLHFEACYYQPIEWAIKEGIKMFDPGAGGRHKRRRGFPATPNYSLHRFYDQKMTQILRNYIPQINEMEQEE 377 Cyanothece
WP_006196374 299 YWGSFQEIDCLHFDACYYTPIEWAIAHNIQSFDPGAGGRHKKRRGFPAMPNYSLHRFYNSRLEQIIPPYIREVNQLEQQE 378 Nodularia spumi...
Q1QKK7       399 ARELTDAGPFRK 410 Nitrobacter hamburgensis X14
Q31P02       374 IEAINAELPFSR 385 Synechococcus elongatus PCC 7942
Q7V3H1       374 IELENNSIPFK- 384 Prochlorococcus marinus subsp. pastoris str. CCMP1986
Q7VE88       375 INASNNEVPFIH 386 Prochlorococcus marinus
Q8DHT3       386 IDTINADLPMKS 397 Synechococcus elongatus
Q10W29       379 MERINEDLPFIQ 390 Trichodesmium erythraeum IMS101
P74568       378 IDAINQDLPFSR 389 Synechocystis sp. PCC 6803
Q7NE42       371 IDDLNNDLPMKE 382 Gloeobacter violaceus
WP_009547674 378 IDAINQDLPFSK 389 Cyanothece
WP_006196374 379 MAAINQDLPFNL 390 Nodularia spumigena
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap