Conserved Protein Domain Family
MtrG

?
pfam04210: MtrG 
Tetrahydromethanopterin S-methyltransferase, subunit G
The N5-methyltetrahydromethanopterin: coenzyme M (EC:2.1.1.86) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump.
Statistics
?
Aligned: 16 rows
Threshold Bit Score: 84.6013
Threshold Setting Gi: 503179193
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
HusnBIG:Mpsy_2183  7 KIPSVVVDPADFSTVLERLNKIDEKVEFVNSEISQRIGKKVGRDIGILYGAVTGIIIFLLYVL 69  Methanolobus psychrophilus R15
jgi:Mmah_1782      9 NIPAVVVDSEDFDKILKKLNDIDEKIEFANSEITQKIGKKVGRDIGILYGAVAGILMFLLYIS 71  Methanohalophilus mahii DSM ...
Q8TU05             4 KAPAAYVDPAEFNEVMKRLEKIDEKVEFVNSEVAQRIGKKVGRDIGILYGAVVGLLLFLIYVS 66  Methanosarcina acetivorans C2A
A0B8Y0            11 vVPVAVVDRDQYREIMARLDKIEEKIEFYSAEKFMRAGKSVGRDLGVAYGVCAGLIIILAYIL 73  Methanothrix thermoacetophil...
sklmb:Mhar_2096    8 VVPSVVVDPDQYREVLDKLAKIDEKIEFVSAEIAQRQGKKIGRDIGVLYGVCGGLILVLAYYL 70  Methanosaeta harundinacea 6Ac
O32868             6 SVPKMVAPEDDIREIHSRLDEIERRLDFVWGEVYQRFGKRIGRDIGILYGLVIGLYLCMLYIL 68  Methanopyrus kandleri AV19
jgi:Mfer_0777     10 TIPRVLVSVDEYNKIDERLDEMEKKVDFAAGEYFERLGQQIGRDIGIAYGVILGIIILIIFFA 72  Methanothermus fervidus DSM ...
NZAGRC:Abm4_1519   6 TTPSVMVDSEEFNKAMVKLDDAQEKVEFALGEYSQRLGQQTGRDLGILYGMMIGLAVMVVFIK 68  Methanobrevibacter sp. AbM4
O27225             8 TIPRVLVSADEFNKANERLDDIEEKVEFTVGEYSQRIGQQIGRDIGILYGIVIGLIILAVTNI 70  Methanothermobacter thermaut...
Q6LWY8             3 EIPTVVTPTKDYKRLQAKLDEIENTVENTNAEIIQRTGKKAGRDVGIAYGLAIGFIFVYVLGT 65  Methanococcus maripaludis S2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap