Conserved Protein Domain Family
TPD52

?
pfam04201: TPD52 
tumor protein D52 family
The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologs from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologs of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family. These proteins have an amino terminal coiled-coil that allows members to form homo- and heterodimers with each other.
Statistics
?
Aligned: 23 rows
Threshold Bit Score: 158.741
Threshold Setting Gi: 27808682
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3SYU8         20 DSMTDVPVDTAVAAQAPAv-eGLTETEAEELRAELAKVEEEIVTLRQVLAAKERHCGELKRKLGLSTLEGLKQNLSRSWH 98  cattle
NP_989546      12 QSLHEADEDMVTDVDFTS---MISEEEKEELKAELAKLEDEISTLRQVLAAKEKHLIEIKQKLGMSLMNELKQNFSKSWH 88  chicken
3_pfamImport    4 QPLQETDEELATDIDYSE---TISEEEKEELKSELFKLENEIVTLRQVLAAKEKHLVEIKQKLGVSMMNELKQNFSRSWH 80 
XP_015215213   12 EPLQEVDEDVVAEVDLNN---SVSEEEREEIQTELAKLEEEIAALKQVLAAKEKHHAELKLKLGMNPLNDLKQNVSKSWH 88  spotted gar
14_pfamImport   4 EPLQEVDEEMVSEVDLNN---TITEEEKEEMHNELTKLEEEIATLRQVLSSKEKRHSELKQRLGITPLSELRHNLSRGWN 80 
11_pfamImport   4 EPLREADEDAASEVHLNNs--TMTEEEREEIQQELVKLEEEIGTLKQVLSSKEKQQAELRQKLGITPLSELKNNFSRSWH 81 
12_pfamImport   4 GPLKETDEDSGSEVNLNSs--IMTEEEREEILQELAKLEEEIGTLRQVLSSKEKQHADLRQKLGINPLNEIRSNFNRGWR 81 
13_pfamImport   4 DSIPEVGEDAVTTVGETTpstALTEEEQEELRNELIKVEEEIQTLSQVLASKEKQVAEIKRKLGITPLNELRQNLSKSWQ 83 
15_pfamImport   4 EPIPEVGEDAVSTVSLSAp--ALTEEEQEELRAELAKVEDEIQTLSQVLAAKEKHVAEIKRKLGISPLNELKQNITKGWQ 81 
XP_003269526   52 DPVPEEGEDVAATISATE---TLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQ 128 northern white...
Q3SYU8         99 DMQVSNAYKKtqetlsqagQKTSAALSTMGSAISRKLGD-----------------------MRnSATFKSFEDRVG--- 152 cattle
NP_989546      89 DMQTTSAYKKthetlshagQKATAAISNVGTAISKKFGDmrshsisys-----irhsismpaMRnSPTFKSFEEKVEttv 163 chicken
3_pfamImport   81 DVQTHSAYKKtqetlsqagLKATAAITNVGSAIGKKLGDmrshsisys-----irhsismpaMRnSPTFKSFEERVEntv 155
XP_015215213   89 EVQTSTAYKKtqetlstagQKATAALSNVGTAISRKFGD-----------------------MRnSPSFRSFEEKVEstv 145 spotted gar
14_pfamImport  81 DMQTSTAYKKtsetlstagQKTTAAFSNLGSAISRKFGDmstqpsysi------rhsvsmptMRnSPSFKSFEEKVEntv 154
11_pfamImport  82 DVQTSVAFKKtsetfstagQKTSAAFSTFGSAITRKLGD-----------------------MRnSPSFKSFEEKVEstv 138
12_pfamImport  82 DVQTSVAYKKtsetlstagQKTSAAFSTLSSTISRKFED-----------------------MRnSPSFRSLEEKMEntv 138
13_pfamImport  84 EVTTSTAYRRtsetlsqagQKATATFTSVGSAISRKLEDvrlqsfsnsfsirsiqhstsmpvMRnTPTFKSFEDRVE--- 160
15_pfamImport  82 DMTASTAYKKtsetlsqagQKATAAFSSVGSAITKKLED-----------------------VRnSPTFKSFEEKVE--- 135
XP_003269526  129 DMTATSAYKKtsetlsqagQKASAAFSSVGSVITKKLED-----------------------VKnSPTFKSFEEKVE--- 182 northern white...
Q3SYU8        153 -TIKSKVVGGRE---NGGDNLPSPTGSGD 177 cattle
NP_989546     164 tSLKTKVGGTSHtggSFEEVLSSTAHASA 192 chicken
3_pfamImport  156 tTLRAKVGSANQtqgSFEEVLSSTAHASA 184
XP_015215213  146 sTLKTKVGGSSSsrgSFEEVLSSTAHASA 174 spotted gar
14_pfamImport 155 tNIKSKVGGTSSg-gSFEEVLSSAAQASA 182
11_pfamImport 139 sTIKTKVGGSGPg-gNFEEVLSSAANASS 166
12_pfamImport 139 sNIKTKVGASESk-gNFEEVLSSAASASS 166
13_pfamImport 161 -SIKTKMSPTPSt-sELGDVSN------- 180
15_pfamImport 136 -TLKTKVSSQPPt-gDFGEVLNSAASASA 162
XP_003269526  183 -NLKSKVGGTKPaggDFGEVLNSAANASA 210 northern white-cheeked gibbon
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap