2YIB


Conserved Protein Domain Family
Birna_RdRp

?
pfam04197: Birna_RdRp 
Click on image for an interactive view with Cn3D
Birnavirus RNA dependent RNA polymerase (VP1)
Birnaviruses are dsRNA viruses. This family corresponds to the RNA dependent RNA polymerase. This protein is also known as VP1. All of the birnavirus VP1 proteins contain conserved RdRp motifs that reside in the catalytic "palm" domain of all classes of polymerases. However, the birnavirus RdRps lack the highly conserved Gly-Asp-Asp (GDD) sequence, a component of the proposed catalytic site of this enzyme family that exists in the conserved motif VI of the palm domain of other RdRps.
Statistics
?
Aligned: 4 rows
Threshold Bit Score: 1501.81
Threshold Setting Gi: 340780312
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YIB_A   1 MSDIFNSPQNKASILTALM-KSTTGD-VEDVLIPKRFRPAKDPLDSPQAAAQFLKDNKYRILRPRAIPTMVELETDAALP 78  Infectious pancreatic...
Q82630   1 MSDVFNSPQARSKISAAFGiKPTAGQdVEELLIPKVWVPPEDPLASPSRLAKFLRENGYKILQPRSLPENEEYETDQILP 80  Infectious bursal dis...
P22173   1 MSDIFNSPQNKASILTALM-KSTTGD-VEDVLIPKRFRPAKDPLDSPQAAAQFLKDNKYRILRPRAIPTMVELETDAALP 78  Infectious pancreatic...
Q8AZL8   1 MSDVFNTPHARRTITQALG-LTNVSDrTQDWLLPEPWNPPMDPIKNSQEAAEYLQRNQYRMLKPRAIPENTPLDTSELFP 79  Blotched snakehead virus
2YIB_A  79 RLRQM--VEDGKLKDTVSVPEGTTAFYPKYYPFHKPDHDEVGTFgAPDITLLKQLTFFLLE-----NDFPTGPETLRQvr 151 Infectious pancreatic...
Q82630  81 DLAWMrqIEGPVLKPTLSLPIGDQEYFPKYYPTHRPSKEKPNAY-PPDIALLKQMIYLFLQvpeatDNLKDEVTLLTQ-- 157 Infectious bursal dis...
P22173  79 RLRQM--VEDGKLKDTVSVPEGTTAFYPKYYPFHKPDHDEVGTFgAPDITLLKQLTFFLLE-----NDFPTGPETLRQvr 151 Infectious pancreatic...
Q8AZL8  80 HLAEF--VGSGAFGTSTLVPAGSTEYIPRYYPTHKPEHNKPTPFgHYDVALLKQMTYQLTNg---kDNPEEEGTTFRQfr 154 Blotched snakehead virus
2YIB_A 152 eAIATLQYGSGSYSGQLNRLLAMKGVATGRNPNKTPKTVGYTNEQLAKLLEQTLPINTPKHED---PDLRWAPSWLINYT 228 Infectious pancreatic...
Q82630 158 -NIRDKAYGSGTYMGQATRLVAMKEVATGRNPNKDPLKLGYTFESIAQLLDITLPVGPPGEDDkpwVPLTRVPSRMLVLT 236 Infectious bursal dis...
P22173 152 eAIATLQYGSGSYSGQLNRLLAMKGVATGRNPNKTPKTVGYTNEQLAKLLEQTLPINTPKHED---PDLRWAPSWLINYT 228 Infectious pancreatic...
Q8AZL8 155 dTIVEQQYGSGTSQGQLARLVAMKEVATGRNPNKSPKELGLSMEEIATMLEQTLPIGQPGGDEg-wPSLTTTLSELLNPA 233 Blotched snakehead virus
2YIB_A 229 GDLst---dkSYLPHVTIKSSAGLPYIGKTKGDTTAEALVLADSFIRDLGR-----AatSADPEAGVKKTITDFWYLSCG 300 Infectious pancreatic...
Q82630 237 GDVdgefeveDYLPKINLKSSSGLPYVGRTKGETIGEMIAISNQFLRELSAllkqgAgtKGSNKKKLLSMLSDYWYLSCG 316 Infectious bursal dis...
P22173 229 GDLst---dkSYLPHVTIKSSAGLPYIGKTKGDTTAEALVLADSFIRDLGR-----AatSADPEAGVKKTITDFWYLSCG 300 Infectious pancreatic...
Q8AZL8 234 EGM-------DYLPHITMKSSSGLPFIGKTKGETVTSALAICDTFLREVSEcvkegA--MASDNQKLQKLLQDYWYLSCG 304 Blotched snakehead virus
2YIB_A 301 LLFPKGERYTQVDWDKKTRNIWSAPYPTHLLLSMVSTPVMNESKLNITNTQ-TPSLYGFSPFHGGMDRIMTIIrdsLDND 379 Infectious pancreatic...
Q82630 317 LLFPKAERYDKSTCCTKTRNKWSAQSSTHLMISMITWPVMSNSPNNVLNIEgCPSLYKFNPFRGGLNRIVEWI---MAPD 393 Infectious bursal dis...
P22173 301 LLFPKGERYTQVDWDKKTRNIWSAPYPTHLLLSMVSTPVMNESKLNITNTQ-TPSLYGFSPFHGGMDRIMTIIrdsLDND 379 Infectious pancreatic...
Q8AZL8 305 LLFPKAERYEKKAWLTKTRNIWSAPFPTHLLLSTISWPIMNSSKNNILNVPeCVSLYGFNPFSGGMDAVVTNIl--AQPD 382 Blotched snakehead virus
2YIB_A 380 EDLVMIYADNIYILQDNTWYSIDLEKGEANCTPQHMQAMMYYLLTRGWTnEDGSPRYNPTWATFAMNVAPSMVVDSSCLL 459 Infectious pancreatic...
Q82630 394 EPKALVYADNIYIVHSNTWYSIDLEKGEANCTRQHMQAAMYYILTRGWS-DNGDPMFNQTWATFAMNIAPALVVDSSCLI 472 Infectious bursal dis...
P22173 380 EDLVMIYADNIYILQDNTWYSIDLEKGEANCTPQHMQAMMYYLLTRGWTnEDGSPRYNPTWATFAMNVAPSMVVDSSCLL 459 Infectious pancreatic...
Q8AZL8 383 ETLFLIYADNIYIYMDRTWFSIDLEKGEANATPEHAQAVSYYLLTRGWTqDDGSPAFNATWATIAMMIAPSLVVDSSCLF 462 Blotched snakehead virus
2YIB_A 460 MNLQLKTYGQGSGNAFTFLNNHLMSTIVVAEWVKAGKPNPMTKEFMDLEEKTGINFKIERELKNLRETIVEAVETApQDG 539 Infectious pancreatic...
Q82630 473 MNLQIKTYGQGSGNAATFINNHLLSTLVLDQWNLMKQPSPDSEEFKSIEDKLGINFKIERSIDDIRGKLRQLVPLA-QPG 551 Infectious bursal dis...
P22173 460 MNLQLKTYGQGSGNAFTFLNNHLMSTIVVAEWVKAGKPNPMTKEFMDLEEKTGINFKIERELKNLRETIVEAVETApQDG 539 Infectious pancreatic...
Q8AZL8 463 MNLQLKTYGQGSGNAWTFLINHTLSTILVGKWIEAGQPNPRSKEFMDLEAATGINFKIEREIEGLPTRLQEAMDKAvHTG 542 Blotched snakehead virus
2YIB_A 540 YLADGSDlpPIRPGKAVELDLLGWSAIYSRQMEMFVPVLENERLIASAAYPKGLENKALARKPGAEIAYQIVRYEAIRLV 619 Infectious pancreatic...
Q82630 552 YLSGGVE--PEQPSPTVELDLLGWSATYSKDLGIYVPVLDKERLFCSAAYPKGVENKSLKSKVGIEQAYKVVRYEALRLV 629 Infectious bursal dis...
P22173 540 YLADGSDlpPIRPGKAVELDLLGWSAIYSRQMEMFVPVLENERLIASAAYPKGLENKALARKPGAEIAYQIVRYEAIRLV 619 Infectious pancreatic...
Q8AZL8 543 FLGDGTTnpPEKEGPTVDLDLLGWSATYSRHMDMWVPVLDKERLLSSAAYPKGLENKDLKGKPGAEIAYKIVRNEALLMV 622 Blotched snakehead virus
2YIB_A 620 GGWNNPLLETAAKHMSLDKRKRLEVKGIDVTGFLDDWNNMSEFGGDLEGITLsePL--TNQTLVDINTPLDSFDPKARPQ 697 Infectious pancreatic...
Q82630 630 GGWNYPLLNKACKNNASAARRHLEAKGFPLDEFLAEWSELSEFGEAFEGFNI--KLtvTPESLAELNRPVPPKPPNVNRP 707 Infectious bursal dis...
P22173 620 GGWNNPLLETAAKHMSLDKRKRLEVKGIDVTGFLDDWNNMSEFGGDLEGITLsePL--TNQTLVDINTPLDSFDPKARPQ 697 Infectious pancreatic...
Q8AZL8 623 GGWNYPLIARSLMANTSAARNNLRQKGVPLDTLTRDWEKMTEFSDIFEDLPIdtKLevTSEFLQRLNLRGERKQPNVNKH 702 Blotched snakehead virus
2YIB_A 698 TPRSpkkTLDEVTTAITSGTYKDPKSAVWRLLDQRTKLRVSTLR---DQALALk---PASSSVDnWAEATEElaqqQQLL 771 Infectious pancreatic...
Q82630 708 VNTG---GLKAVSNALKTGRYRNEAGLSGLVLLATARSRLQDAVkamAEAEKLhkskPDDPDAD-WFERSETl---SDLL 780 Infectious bursal dis...
P22173 698 TPRSpkkTLDEVTTAITSGTYKDPKSAVWRLLDQRTKLRVSTLR---DQALALk---PASSSVDnWAEATEElaqqQQLL 771 Infectious pancreatic...
Q8AZL8 703 HLRTk--GLKKCVSALKQGACRNPTTVAGLKLTAYSKSRINKAKavfDEINNL----PKTESDD-WSDRMDD----ADRL 771 Blotched snakehead virus
2YIB_A 772 MKAnNL----LKSSLTETREALETIQSDKIIAgKSNPEKNPGTAANPVVGYGEFSEKI---------------------P 826 Infectious pancreatic...
Q82630 781 EKA-DIaskvAHSALVETSDALEAVQSTSVYTpKYPEVKNPQTASHPVVGLHLPAKRAtgvqaallgagtsrpmgmeapT 859 Infectious bursal dis...
P22173 772 MKAnNL----LKSSLTETREALETIQSDKIIAgKSNPEKNPGTAANPVVGYGEFSEKI---------------------P 826 Infectious pancreatic...
Q8AZL8 772 MKAnNLymreARSALEDVHNSLLALSGETVKA-KTPQEKSTEKVSNPVVGYRLPAERAtgvqhallg---vgvsrpsegA 847 Blotched snakehead virus
2YIB_A 827 LTPTQKKNAKRREKQR 842 Infectious pancreatic necrosis virus
Q82630 860 RSKNAVKMAKRRQRQK 875 Infectious bursal disease virus chicken/UK/UK661/1989
P22173 827 LTPTQKKNAKRREKQR 842 Infectious pancreatic necrosis virus - Jasper
Q8AZL8 848 LTKNARKMKKRREKAR 863 Blotched snakehead virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap