Conserved Protein Domain Family
Nop14

?
pfam04147: Nop14 
Nop14-like family
Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production.
Statistics
?
Aligned: 122 rows
Threshold Bit Score: 572.639
Threshold Setting Gi: 347963742
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q54K79               27 TPVVKIVNPFDRKVNKTKHVVLNRQVKGAS-----GDLGQSRYNAIEKRKKTILVEMNQMNKSNKFIDARIGENDASMSE 101  Dictyos...
EFN68887             19 QNSKKQLNPFEVHINRDKQNVLGRKNKNDR-----GLPGVSRAKAINKRKQSLLQEYKLKNKDNVFLDKRIGEKNFDMST 93   Florida...
EFZ16794             13 QQKNKKLNPFEVHINRDKQKVLGRKSKNDC-----GLPGVSRAKAINRRKQSLLQEYKLQNKDNVFIDKRIGEKNCAMSM 87   red fir...
EGI62575             15 QKNKKQLNPFEVHINRDKQKVLGRKSKNDH-----GLPGISRAKAINRRKQSLLQEYTLQNKNNVFLDKRIGEKNCSMSI 89   Panaman...
WGS:AAQB:GK12987-PA  33 QTATKGQNAFDIHVNKEKFQILGRICKHDR-----GMPGVSRAKALQKRAQTIGKQYAVKNKTNKFVDRRIGKHLSGDQL 107  Drosoph...
EDV91525             30 AQTAKRLNPFDVHVNKEKFKILGRICKHDR-----GMPGVSRAKALEKRAQTIGKQYAVKNKTNTFVDKRIGKHLSGDQL 104  Drosoph...
EDS33046             18 LQGVKKPNPFEIQTSKTKFNVLNRDTQTNRq---tGLSGVQRARAIEKRKQTLGQEYLQKHKSNRFVDQR---RDGRNMN 91   souther...
Q16HE6               20 LQGVKKPNPFEIQTSKAKFTILNRDSQPNRrf--aGIPGVQRARAIEKRKQTLGQEFLLKNKSNRFTDQR---KDGRNMS 94   yellow ...
ETN65140             22 GQGVRKPNPFETHVLKSKFTVLNRDPAVGHsirdtVKPGAIRARAIEKRKQTLGKEFATLHKANRFVDAR---KDGKNNR 98   Anophel...
XP_001606853         22 QQTKKTLTPFEVHVNRDKQKVLGRKSKADT-----GLPGIARTKAIAKRKNTLLNEYKVRDKDNIFLDRRIGERNSGMTQ 96   jewel wasp
Q54K79              102 EDKML-ARFQREKlr------nKNLYNLNDNDQeeLTHMGQSLGNslgsnsmslSEGNDDYVASD-------DELDEVGK 167  Dictyos...
EFN68887             94 EDKAM-ARFAMERmkm---hkkKNIFNLNDDEV--LTHRGQTLEE---------IEKFDD-PKSDdef-sddENVSGKLD 156  Florida...
EFZ16794             88 EDKAI-ARFATERikt---ykkESIFNLN-DDI--LTHRGQTLEE---------IEKFDD-PKSDdef-sdnENVSGKLQ 149  red fir...
EGI62575             90 EDKAT-ARFAKERmka---ykkESIFNLN-DEI--LTHRGQTLEE---------IEKFDD-PRSDdef-sdnENDSGKLD 151  Panaman...
WGS:AAQB:GK12987-PA 108 TESVMnARFLAEKmsqvrasnkAERYNLNDDEL--LTHRGQTLEE---------IEQYRD-ERSDd-----eELDDEGLD 170  Drosoph...
EDV91525            105 TESVMnARYLAEKlsqvrasnkAEKFNLNDDEL--LTHRGQTLEE---------IEQYRD-ERSDd-----eDLDDEGLD 167  Drosoph...
EDS33046             92 REELMaERKSGASr-------rKEIYNLNDSVK--LTHRGQTLEE---------IERFDDAVDNDid----sEDEGGQLD 149  souther...
Q16HE6               95 RDQMAtERKSAATr-------rKELYNLNDTVK--LTHRGQTLEE---------IERFDDAVDNDdd----sDDDGGQLE 152  yellow ...
ETN65140             99 PQSNAsRR--------------KEMYNLN------LTHRGQTLAE---------LERFDDPVDNDdd----eDEEDGLLD 145  Anophel...
XP_001606853         97 EDKAM-ARFAAERvka---hskKNIFNLNDEEV--LTHRGQSLMD---------IEKYDD-PRSDeddysddENKTGKLD 160  jewel wasp
Q54K79              168 EFLSERQRFGGGDDDSNGngerQDRHKSKKEIYQEIIEKSKIGKAERAKEKLKKEALTRDLDEEFNLIRGELILtNGNNS 247  Dictyos...
EFN68887            157 KNFVEEVHFGGGVLSKLD------SALSRKDLIDQLITESKKRKAEKQKIREQTIDLTEKLDSEWKDLLPIMS--TSKKS 228  Florida...
EFZ16794            150 KNFVE-AHFGGGTLSTAD------STLSRKDLIEQLIVESKKRKAEKQKIREETIDLTEKLDSEWKDLLPFMF--ASKKS 220  red fir...
EGI62575            152 RNFVQEAHFGGGILSKAD------SALSRKDLIDQLIAESKKQKAEKQKIRKETIDLTEKLDSEWRDLLPVMS--ASKRS 223  Panaman...
WGS:AAQB:GK12987-PA 171 ADFTSAANFGGGd---------EETAQDRQTAIDKMILEQKRRKNEIAKEKDEVYDLTEKLDANYKLLLPLVAK------ 235  Drosoph...
EDV91525            168 AEFTSAAHFGGd----------GDAPQDRQTAIEEMITEQKRRKNEIAKDKDEVNDLTEKLDANYKQLLSLVAQ------ 231  Drosoph...
EDS33046            150 DEFTEAAHFGGGd---------TDNGRDRKTVIEEMIAESKRKKAEKQRENDEVFEMTQKLDKNWQSLAAVVG------- 213  souther...
Q16HE6              153 ADFMEAAHFGGGEEd------gEDRGRDRKTVIEEMIAESKRRKAEKQRENDEVYEMTQKLDQNWQSLMSVVG------- 219  yellow ...
ETN65140            146 ESFTNAAHFGGGSDEEGe---dGGGRKDRKTVIEEMIANSKRQKVEKQRENDEVYEMMQKLDSSLKALMPQVG------- 215  Anophel...
XP_001606853        161 KKFVGDAHFGGGVLSKPD------SEMSRKDLIEQLIVESKKRKAERQKVREQTIDLTEKLDSEWRDLLPLVA--SSNKA 232  jewel wasp
Q54K79              248 NSSNNNNLQddaflkfqaeqrsneqkfasssssnstndstkkpkeAHDdFDELLYELQGESRAHATDRTKTKEEQMKEEM 327  Dictyos...
EFN68887            229 AEDDSQTVK------------------------------------ADA-YDISVRQLIFEARGNPSEKLKSEEEIVEEEK 271  Florida...
EFZ16794            221 KEDIDEITK------------------------------------ADT-YDIAVRQLKFEARGHPSEKLKSENEIIQEEK 263  red fir...
EGI62575            224 MEN-DETMK------------------------------------TDT-YDIAVRQLKFEARGNPSEKLKSEEQIIQEEK 265  Panaman...
WGS:AAQB:GK12987-PA 236 ATKDDQAPKp----------------------------------pPDA-YDKLLKEMIFEPRGSVSDKLINVEELAKQEA 280  Drosoph...
EDV91525            232 ATKDEQHEKp----------------------------------pADA-YDKLLKEMIFEPRGSVTDKLIKPEELAKQEA 276  Drosoph...
EDS33046            214 GHMKGDSERp----------------------------------kLDD-YDKVMREMIFERRGKPADKLKSAEELAKIEL 258  souther...
Q16HE6              220 DHMKGDSVRp----------------------------------qLDD-YDKIMREMIFERRGAPADKLKSEEELANIEK 264  yellow ...
ETN65140            216 EHLRKDSDKp----------------------------------kLDD-YDRMMREMIFERRGAPAEKLKSEEQ-ARTEK 259  Anophel...
XP_001606853        233 LK-EVELEKp----------------------------------kADD-YDIAMRELKFEARGMPTDKLKPEEQIAKEEK 276  jewel wasp
Q54K79              328 ERLQQKEKERLERASGDYVELEADDNVKDSDKnlprkvldrlkakdnkpkmlTADSLDDENEVLNINGVdt-------vf 400  Dictyos...
EFN68887            272 EKLEKLEADRLARMK--GFVSDTSNQY--KHK--------------------SADDLDDGFMVETVVDDtddinsvinda 327  Florida...
EFZ16794            264 QKLEKLEADRLARMK--GFMSDISNQY--WHK--------------------SADDLEDGFVMETVIEDnddvt-sitte 318  red fir...
EGI62575            266 EKLEKLEADRLARMK--GFISE-TGQF--RHK--------------------SADDLDDGFIMET-IEDtddiiddsiid 319  Panaman...
WGS:AAQB:GK12987-PA 281 ERLEKMENERLRRMKADGEEDEKDAKARPKHR--------------------SADDLDDGYFVAGDDDEp---------- 330  Drosoph...
EDV91525            277 ARLEKLENERLRRMKFD--GEEQETNVHIPHR--------------------SADDLDDGYFVAGNEEEe---------- 324  Drosoph...
EDS33046            259 EKQERLERERLARMAGV------ENGAKAKHR--------------------SADDLDDGYFVQPAVGSs---------- 302  souther...
Q16HE6              265 QKLEKLERERLARMKGD------DVEAKGNHR--------------------SADDLDDGYLLQPIDGNe---------- 308  yellow ...
ETN65140            260 QKRETLERERLERMKS---ETAEGSNTAKSHR--------------------SADALDDGAYLADDVNGd---------- 306  Anophel...
XP_001606853        277 IKLEKLEEDRLARMK--GFSEEAEFQR--KHK--------------------SADDLDD-FHIERIVDEgs--------d 323  jewel wasp
Q54K79              401 Y-----------------NPQIdSDDDNNNKdnsdseddq-------------tneqsseleTDDEDKSDE----DEEGE 446  Dictyos...
EFN68887            328 NnsneedsdidnnevndnDINNkNENKSENIaekdtks------------------eiedlnNEDLEIEEM----DDEDS 385  Florida...
EFZ16794            319 TsineenseidenvnddkQKGNkLEDASDKKtvkgiknksiyte-----asnikdesdtdlnDEDLAIENL----DDESE 389  red fir...
EGI62575            320 Inineenn---dkddydkQTENeSEDIADEEiiknintrkdssknqermyskssikdksdlnDKDSESENL----DDESE 392  Panaman...
WGS:AAQB:GK12987-PA 331 Ddtlaydl----dgnlgtHLNGkTNKVQSDKpgd-------------------------deeDDDEEDGEE----EEEEE 377  Drosoph...
EDV91525            325 Gddvlayd---ldgnlgtHLSSkKETEQSNTkl----------------------------deEGNEDEDD----DDEDE 369  Drosoph...
EDS33046            303 D-----------------GVDVdRENGEDSSaydprnitk-------------eaenghddaEDQAEEDESgsdsEDSEE 352  souther...
Q16HE6              309 E-----------------ASYNeADVDAEDGlynprqise-------------egkedkadvEDESDDEDSeagsEDEVS 358  yellow ...
ETN65140            307 Ea----------------QDNDeDDDGALEPqydarnlsk-------------eatdddgdeADGDQSSDD----SEEEN 353  Anophel...
XP_001606853        324 Nendapdl----qsilakHKNKiKNNENIEAddrdede------------------egeedeDEEAE-EDE----NEEGE 376  jewel wasp
Q54K79              447 EG-DE------------------EDSDLDLKDDEILsgqEDDEEEEEekstk---------------------------- 479  Dictyos...
EFN68887            386 E--------------------------DSFIDLKVS---DSSEDEEnkaekrvkftnnlttgqttqtnqldqtcpk---- 432  Florida...
EFZ16794            390 ---------------------------DDFSDLKMS---ELSSEDEnktqvprknekyvmfindltqgtkqikqsdkisc 439  red fir...
EGI62575            393 ---------------------------DDLSDLKMS---ESSCENEsetevafvneskkrvmfsnnltedtkqinqsnk- 441  Panaman...
WGS:AAQB:GK12987-PA 378 EDsDD------------------DSEVDNLSDLKES---DSESDAEaapeqsatk------------------------- 411  Drosoph...
EDV91525            370 EEeES------------------DSELDNLSDLKES---DSESEAEetaqqtqv-------------------------- 402  Drosoph...
EDS33046            353 GSdDE------------------AADKDNLSDLV-----EDSDEDEpvdkevnsska----------------------- 386  souther...
Q16HE6              359 ED-ES------------------EDGVDNLSDLK-----EDSESEEevaatemnkqs----------------------- 391  yellow ...
ETN65140            354 DG-SS------------------SEEEDNLSDLQNG---QSSESEEeeeevvpippavp--------------------- 390  Anophel...
XP_001606853        377 EgsedenlseeadeddgeeeedgeeseDDLSDLKES---ESSEDEEEientdindkekatkrdnivhkktesvkdssvks 453  jewel wasp
Q54K79              480 --------------------------------klktnKKSKEEVNETIPFTFDTPKSIEELDEWLLNR-TSEEKETILTR 526  Dictyos...
EFN68887            433 -------silkqnnnstcvqnsfddrkqeirndllrrKEIMEKARKELPYTYNAPENFEELEKLLKNH-NADYQSVIVDR 504  Florida...
EFZ16794            440 ----ksilkqsnnthilnssdknknqeiyiknnllkqKEIMEQARKELPYIYNVPECLEELEKLLSHQ-SADYQSAIIDR 514  red fir...
EGI62575            442 -----ishksilkqsnsthvqnscdkiqqirndllkrKEIMEKARNELSYTYSAPESFEELEKLLRHH-NADYQSVIVDR 515  Panaman...
WGS:AAQB:GK12987-PA 412 -----------------------------spkkksstSIESKIEDTTIPFTLKMPKTYEDFTQLFDQYpQPGQQATIVER 462  Drosoph...
EDV91525            403 ------------------------------kskrqkqQQTTASMDTSIPFTIKMPKTYEDFGELLSKY-SPAQQATVVER 451  Drosoph...
EDS33046            387 --------------------------seeqnrrylaqQKEREQAAAEVPLVFEMPKSYEELSSLLNRY-SPIKRAIVFER 439  souther...
Q16HE6              392 ---------------------------kqpdpetqaaKQAREKAEAELPFTFELPRKYEQLEELLQRR-SSAEQLVILDR 443  yellow ...
ETN65140            391 ------------------------sakkqeitkdrktVPEPAKINYDIPAFLEFPKEYDTFAELLTNR-DIGYQAALVAK 445  Anophel...
XP_001606853        454 vanddstkgqkspvivntetvdestentesyvnieerEAIMEKARQELPYTFKAPATYEELLDLFKDK-NPDYQAVIVER 532  jewel wasp
Q54K79              527 IGV---CNHVSIKPQNKDKMKDYLPILYQRFINIAKPIK--EDdqdessnpidWIELDVLSKYIFEISQDVPIVSGITSK 601  Dictyos...
EFN68887            505 IIK---CNHWTLNGKNKEKMSNLFIYLLQHINNCASI----ENidl----vkcFQIFDRLCPYLYDLAHLNPANTRAYIE 573  Florida...
EFZ16794            515 IIK---CNHWTLGSRNKEKLSNLFVYLLQYINNCAFT----ENvddl---vkcFQMFDRLCPYLYDLAHMNPQNAETYIQ 584  red fir...
EGI62575            516 IIK---CNHWSLDGRNREKMSNLFVYLLQHINNCAST----ESaddl---ikcFQIFDRLCPYLYDLAHMNSENAKICIQ 585  Panaman...
WGS:AAQB:GK12987-PA 463 LIK---CHHPKLEGVNREHVVKLYSYLLQYIKDRFED----ASeqdi---gknFKLISGLMPHLYDLTQLNPLRMSSTLL 532  Drosoph...
EDV91525            452 IIK---CNHPKLEGVNRENVVKLYAFLLQFIKDMFED----ASeqdi---lshFQLLAQLMPHMYDLTQLNPERMSNTLL 521  Drosoph...
EDS33046            440 ILS---SNNGRAVHLNKSRMISLFAFAVQYLNDCFASTLpaTVse-------aFETVSGLTPFLYDLAKMNPRETATCFQ 509  souther...
Q16HE6              444 MVK---SNNAKFSRENKQKMVSLYAFLLQHLNDLFAAVGleSLhd-------nFRLLDGLSPFLYDLAKINPTETSQCFL 513  yellow ...
ETN65140            446 LVEkcnQNHPT----SKANRRLLFVYLLQLITDRFSSPG--AGagsi---endFKALHSLTPFLYDLAQKDPHETGPLFV 516  Anophel...
XP_001606853        533 IVK---CNHWKLAERNKEKLLNLFSYLMQYLDTLASV----NSlkdt---ekfFKIFDRLCPHLYDLTQANPVGTKIHLQ 602  jewel wasp
Q54K79              602 DLINSCYKR-ICKkleiqskLNYWPNQQELLVIKLIGNVFPTSDFQHPVVTPTIEALNFFLSHCPIRN-ANDIISSLFTM 679  Dictyos...
EFN68887            574 EVLKEKYDK-FATn------KKRYPGTDTLIFFKLVSLLFPTSDFRHPIVTPCLVFMSEILLQARIKKyRSDISKGLFIC 646  Florida...
EFZ16794            585 QVIKEKHIE-FEKn------KTTYPNMQMLIFFKLVSLLFPTSDFRHPVVTPCLVFMSQILLKARIKKyRSDISKGLFIC 657  red fir...
EGI62575            586 EVIKEKYDK-FEKn------KTKYPGMDTLIFFKLVSLLFPTSDFRHPITTPCLIFMSQILLKARIRKyRSDISKGLFLC 658  Panaman...
WGS:AAQB:GK12987-PA 533 EVIKEKYAAyRKN-------HKIYPTLDTFIYFKLVANIYSTSDFRHPLATPTYIFIQHILSRARVRT-RQDIGMGLFLV 604  Drosoph...
EDV91525            522 DVIKEKYAEyRKN-------HKVYPSLDTLIYFKLVSNLYSTSDFRHPVATPTYIFMQHILSRARIRT-RQDIAMGLFLV 593  Drosoph...
EDS33046            510 DVVREKQEEfRKR-------PRQYPPLDTLVFLKLVPLLFSASDFRHPVVSPALVFLSEILSRCQVRD-RKDITAGMFLV 581  souther...
Q16HE6              514 DVIKEKQEEyRKK-------PRLYPHLDSLIFLKLVPVLFSASDFRHPVVTPALVFISQLLSRCQVRN-RKDVTSGLFLV 585  yellow ...
ETN65140            517 EVIQEKQSE-YRKn------PRRFPALSTLAIVKLVPLLYSASDVRHSVVTPVLVFVSEMLTRCNVRT-RRDLTHGLFLV 588  Anophel...
XP_001606853        603 EILKQKHDQ-FENn------IKVYPGLDTLFLFKLVSIIYPTSDFRHPIVTPCLVFMSQILLRCKVKK-KSDISKGLFVC 674  jewel wasp
Q54K79              680 NLLFFYLSPSKRYSPEISSLLISLLSTFINhnpptiqttttTTtkpknskNSKTTTATTTTTPSNInsqwasistnilip 759  Dictyos...
EFN68887            647 TLILEYTVLSKRFAPSVINFLRGIIYMATEsmqk---vkiiPPfk---taCKVLVIDKTE---VTIdl------------ 705  Florida...
EFZ16794            658 TLILEYTTLSKRFAPSVINFLRGIIYMATPanltq-kitiiPPfk---ivCKALVINKMEIDLDKIdp------------ 721  red fir...
EGI62575            659 TLILEYTILSKRFAPSVINFLRGIIYIATPanltq-nmkiiPPfk---taHKILVVNKVE---NTNdt------------ 719  Panaman...
WGS:AAQB:GK12987-PA 605 TIALEFGSLSKRLLPCVFNFLQGVVHMSIPkrdve-qveipPPfetigplSKLLAISSSTAKESTSld------------ 671  Drosoph...
EDV91525            594 NIAMEFGSRSKRLLPAVFNFLLGILHMVIPkrqtedqydivPPferdgpfSKLLAIPATKESQALEp------------- 660  Drosoph...
EDS33046            582 TVALECTEQSDRILPAALNFLNGVIYMCAEtkaiq-vvkivPPfksfapwSNLLVLEETVEDVEETk------------- 647  souther...
Q16HE6              586 MTVLECVEQSKRFLPAAINFLNGVLYLCFRkrsit-vvpvvPPfkssaplNNLLALDESTKNCDEKe------------- 651  yellow ...
ETN65140            589 TIVLECVEQSKRFLPAVHCFLTNILILAYPkda-----qpvAKvntfklaPHSLALPSSSGNSDRNa------------- 650  Anophel...
XP_001606853        675 TLILEYTVLSKRWSPAVINYLRGVIYVSLPkpfsk-vikviPPfksvgdtSNILVLEENH-KKSDIdp------------ 740  jewel wasp
Q54K79              760 tillplnylklsnqinvikkiepTQLEFSNLSKsnLEINDELRINILNYLISFLEK-YIRFYSESQfneSLPSLFTNILN 838  Dictyos...
EFN68887            706 ---------------------ngANMFADDLVYeel--ddeFKIRVLLTAINLIIE-FKNQLQELE---AVYSIFQPIHK 758  Florida...
EFZ16794            722 ---------------------nsAHMLASDLINeel--ddeFRIRALLTTVNLLIE-FKNHLQELE---SIYPIFEPILQ 774  red fir...
EGI62575            720 ---------------------nnAHMFANDLIHeel--ddiFRIRSLLTAVNLLTE-FKNQLQELE---AVYPIFEHILQ 772  Panaman...
WGS:AAQB:GK12987-PA 672 ----------------------gQKLQAEDLVTqtv--tldFRVRALDTSLCLIRE-TMELVAEHP---GACYLATPFLP 723  Drosoph...
EDV91525            661 -----------------------QQLQAADLVThtf--tldFKVRAVDATLRLIKNiFEELVGEHI---GACYLANPFLP 712  Drosoph...
EDS33046            648 -----------------------LSLRAEDFVT--GAIDDSFKMRVLNTTLGMIRA-VCSKLSKLD---GAHHIVANFLP 698  souther...
Q16HE6              652 -----------------------YALHCEDFFI--EDVDDSFKLRTLSAALEMIARsF-RQLRDTS---AVHQLSIEVIR 702  yellow ...
ETN65140            651 ----------------------eSKLLAEDFQQtel--tddYKIRLVAATLGMISA-VCKQLDQSE---AIQTIAAGFKR 702  Anophel...
XP_001606853        741 ---------------------atVKMQIEDLVEvem--dddYRLRTFVTALNLLCE-FEKHCSELD---AAFSIFEPILT 793  jewel wasp
Q54K79              839 LLNK-LDTNTMNLKLIEKINSLKQLIDSINKEIINkrkPLILLTSKPQTLRQFNPRFNQVFSFFNK----DPDAERNHTA 913  Dictyos...
EFN68887            759 LLKI-NKFKNYPQNIRSHIKQLRKDLKLLRSKKLE---YIVLEKKRPKPLRTYEPKIMTVYDGKHHkp-mSK--EKAEKE 831  Florida...
EFZ16794            775 LLKI-NEFKQYSVNIRNHVKGLCKELEFLRKKKLE---YIVLKKKKPKPLKTYEPKIMTVYDDKRYks-aSK--EKIEKE 847  red fir...
EGI62575            773 LLKI-NDFKQYPLYVRDHIKKLCTELEFLRNKKLE---YIVQEKKRPKPLKTYEPKIMTVYSEKRYks-tSK--EKAERE 845  Panaman...
WGS:AAQB:GK12987-PA 724 LLNR-LPLKLYPVHVHQHHKEAKELLSQLAEQKQK---RLAPAERKPKALRLLEPRFEAVYDDKRRpk-mSK--AKEERA 796  Drosoph...
EDV91525            713 LLER-LPLKHYPEHVQEHHAAAKSALQQVSAQKMK---RLAPADKKPKALRLLEPRFEVVYDDKRRpk-mSK--QKEERA 785  Drosoph...
EDS33046            699 HLRR-IDEELYPKVLQTALADTRQALQTLHDKPLH---YLVAPEKKPKPLRLLEPKIEATYEDIRRrpknQTLPLREQRR 774  souther...
Q16HE6              703 SLER-LDEELLPAVLKVSLNETLNTVKALHLRPLL---FLLAPEQKPKPLRLLEPKIEAVYDDIRRrpknQQLSDRDKRR 778  yellow ...
ETN65140            703 HLEVlSKTPSLPVFVKKILKELLSKLTEQTKRPLK---YLVAAEKKPKPLRMLEPKIETVYDDIRRrpktAE-SLREQRK 778  Anophel...
XP_001606853        794 LFEC-GSVKRYPSKVREKVKTLIDELKTLKEKVLE---PLAYDKKKPKALRMYEPRIEVVHDGKRHkp-mSK--EKAERE 866  jewel wasp
Q54K79              914 KMKALIKKETKGALREIVKDNQFIQAEKFKKATEERKENEKKRKQIMSELQSEQQE 969  Dictyostelium discoideum AX4
EFN68887            832 KLLHKYKREYKGAIREIRRDRDFLTKVQIAQQIKSDADRKRKVIEIFGDAAMQQSE 887  Florida carpenter ant
EFZ16794            848 KLLHKYKREFKGAIREIRRDRDFLAKVQIGQQIKSDAERKHKVKEIFGEAAIQQSE 903  red fire ant
EGI62575            846 KLLHKYKREHKGAIREIRRDRDFLAKVQIGQQIKSDIERKQKVNEIFGEAAIQQSE 901  Panamanian leafcutter ant
WGS:AAQB:GK12987-PA 797 KLVHKIRREKKGAIREIRRDTAFVQELKLKQILQSDKERHEKVKRIYQEASMQQGE 852  Drosophila willistoni
EDV91525            786 KLLHKIKREKKGAIREIRRDTAFVQDLKLKQQIQSDKERHEKVKRIYQEASMQQGE 841  Drosophila grimshawi
EDS33046            775 KLQQKVKKETRAAAREIRQDNEFLAKMRLHQRVAGDRERREKVKRIFSEATAQQGE 830  southern house mosquito
Q16HE6              779 KLQQKVKKESRAAAREIRQDNEFIAKLQFKQRAASDRERREKVKRIFSDATTQQGE 834  yellow fever mosquito
ETN65140            779 KMQQKIKRASRSAAREIRLDNEYISKLQMKRRLESDRERKEKVRRIFSDATSQQGE 834  Anopheles darlingi
XP_001606853        867 KLLHKLKKETKSAIREIRRDNDFISKVKIKQQIASDAERKRKVKEIFGDAAMQQSE 922  jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap