Conserved Protein Domain Family
Iron_permease

?
pfam04120: Iron_permease 
Low affinity iron permease
Statistics
?
PSSM-Id: 335628
View PSSM: pfam04120
Aligned: 45 rows
Threshold Bit Score: 145.763
Threshold Setting Gi: 504622764
Created: 18-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9I1S8         3 FSRFAQRLSNWAGRPPTFVVALGLILLWAISGPLFDFNDTWQLVINTSTTIVTFLMVFLIQNTQNRDTDALHIKIDELLR 82  Pseudomonas aer...
AIE87061       5 FSRIARWASNIAGSAPAFAACVLLIVVWAAFGPVFHYSDTWQLVINTSTTIITFLMVFLIQNAQNRDAKAIHLKLDELIR 84  Fimbriimonas gi...
WP_012870789   5 FDRLSSRIARMVGSYLAFLVACAVIIIWAASGTWFGFSDTWQLVINTGTTIVTFLMVFLIQATQNRDARATQLKLDELIR 84  Sphaerobacter t...
WP_014809866  13 FRKFAHKCSDIAGSPWIFSAAVTIILLWGITGPFFGFSDTWQLIINTSTTIIIFLMVFLIQNTQNRESKAVQLKLDELIK 92  Desulfomonile t...
WP_012097465   5 FARFALAISEVVGTPRAFLLALALVVVWGLSGPVFHFSDSWQLVINTGTTVVTFLMVFLIQATQNRETRALHLKLDELIR 84  Anaeromyxobacte...
WP_012376981  10 FTSFAKITARATGRPSAFVLAFAVILAWAVTGPLFHYSDTWQLVINTGTTIVTFLMVFLIQNTQNRDTQAIQVKLDELIR 89  Opitutus terrae
WP_013168748  16 FTRFAQWVAVQAGKPTTFAGAAAIIVLWAISGPFFGFGDTWQLVINTSTTIITFLMVFVIQNSQNRDTAALHIKLDELIA 95  Starkeya novella
WP_011996108  24 FTRFSQMAARYTGKPATFIGAMAIIVVWGMTGPLFGFNDTWQLVINTSTSIVTFLMVFLIQNSQNRDTAALQIKLDELIA 103 Xanthobacter au...
WP_005411086   7 FNTIAKKAAAATGSPWTFLAAVAIVVIWGISGPVFGFNDTWQLVINTGTTIITFLMVFLIQHTQNADTAAMQIKLDELIR 86  Stenotrophomonas
ABX02924      10 FTQVSKWTAHITGRPRTFGLAVGVIFLWMISGPLFGWSDTWQLVINTSTTIITFLMVFLIQNTQTRDSEAIQIKLDELIR 89  Herpetosiphon a...
Q9I1S8        83 STRRAHNALLGLDDLDADTLRELRQRYQHMGEQDGETPESVAAEEERQ 130 Pseudomonas aeruginosa
AIE87061      85 AQSGARNKMIDLEKLTDAQLQRLQQEFDKICNEEEPRTAAGRAQEdtk 132 Fimbriimonas ginsengisoli Gsoil 348
WP_012870789  85 AVTDARATFIDIEEGTERDLDTAEAEFRQSRSHDDASGRATARSRRKR 132 Sphaerobacter thermophilus
WP_014809866  93 SMKEARNSFIDLEELSDEELESLQKQFKRLQQRDSSDRGASKEDAERE 140 Desulfomonile tiedjei
WP_012097465  85 AQRRARNIFADLEHATDEELAQLEAEFRRVHARAEARRQAKEASrph- 131 Anaeromyxobacter sp. Fw109-5
WP_012376981  90 AMEGAHNALLNLEDLTDEELEQIRADYAKLATQARKDLRHGRSDTavr 137 Opitutus terrae
WP_013168748  96 KNDLTRNVLLDLEELDDGALEEIRGEYEALAQAERDGKAPVAASRKGk 143 Starkeya novella
WP_011996108 104 RLDGPREVLLDLEDLDEDTLERLRLEYALLADKARESQDSGARREAAC 151 Xanthobacter autotrophicus
WP_005411086  87 ATAEANNELLDLEELDEARLEEIRAEYEQMAREAGDALARVRACHAAR 134 Stenotrophomonas
ABX02924      90 ATQGAHNALLDLEELEEDELDQIRATYQRLSERAREAIRHGLVDTdnp 137 Herpetosiphon aurantiacus DSM 785
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap