Conserved Protein Domain Family
Iron_permease

?
pfam04120: Iron_permease 
Low affinity iron permease
Statistics
?
Aligned: 44 rows
Threshold Bit Score: 144.989
Threshold Setting Gi: 390623515
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Slin_0387     10 FERFASRATQATGSSTAFLLALLTIITWIITGPIFGYSDTWQLVINTGTTIITFLMVFLIQKSQNKDSLAMQLKLNELIA 89  Spirosoma l...
jgi:Astex_1024    16 C--FAQNAAVATGSPWAFGLAVAVVVLWIVTGPLFKFSDTWQLVINTGTTIVTFLMVFLIQNTQNRDAKIMQLKLDELIR 93  Asticcacaul...
jgi:AciPR4_2201   16 FGHFAAVTATYLGSRWAFAGAIGVIVLWAATGPVYHYSDTWQLIINTGTTIVTFLMVFLIQNTQNRDARAMNLKLDELIC 95  Terriglobus...
jgi:Sthe_0302      5 FDRLSSRIARMVGSYLAFLVACAVIIIWAASGTWFGFSDTWQLVINTGTTIVTFLMVFLIQATQNRDARATQLKLDELIR 84  Sphaerobact...
jgi:Anae109_2666   5 FARFALAISEVVGTPRAFLLALALVVVWGLSGPVFHFSDSWQLVINTGTTVVTFLMVFLIQATQNRETRALHLKLDELIR 84  Anaeromyxob...
jgi:Desti_2019    13 FRKFAHKCSDIAGSPWIFSAAVTIILLWGITGPFFGFSDTWQLIINTSTTIIIFLMVFLIQNTQNRESKAVQLKLDELIK 92  Desulfomoni...
FDU:OP10G_3693     5 FSRIARWASNIAGSAPAFAACVLLIVVWAAFGPVFHYSDTWQLVINTSTTIITFLMVFLIQNAQNRDAKAIHLKLDELIR 84  Fimbriimona...
jgi:M446_4617     27 FSDFAAAVARAAGKPVTFALSIAIILIWAVSGPFFHYSDTWQLIINTGTTIITFLMVFLIQNTQNRDGAAIQAKLDELIR 106 Methylobact...
jgi:Mnod_6107      7 FTTFASAIAHAAGRPSAFLLCLVVILAWAVSGPLFHYSDTWQLIINTGTTIVTFLMVFLIQNTQNRDGAAIQAKLDELIR 86  Methylobact...
MSU:OCAR_7479     19 FAEIANWTSQAAGRASTFILAALVVFIWAMSGPIFHYSDTWQLVINTGTTIITFLMVFLIQSSQNRDSAAIQVKLDELIR 98  Oligotropha...
jgi:Slin_0387     90 VNRKASNRLLNVEDLTEAELHALHRFFGQLVEKAKTESSLSQSHSVEE 137 Spirosoma linguale DSM 74
jgi:Astex_1024    94 AASKANTAYIDMENMSEKELTALQTHYEALAKKAREQGDHKAAEAHSE 141 Asticcacaulis excentricus CB 48
jgi:AciPR4_2201   96 SIDAAKNQMINIEHLSDSELDDLTNRYEQVRSQAMKRLGNKAVDEVde 143 Terriglobus saanensis SP1PR4
jgi:Sthe_0302     85 AVTDARATFIDIEEGTERDLDTAEAEFRQSRSHDDASGRATARSRRKR 132 Sphaerobacter thermophilus DSM 20745
jgi:Anae109_2666  85 AQRRARNIFADLEHATDEELAQLEAEFRRVHARAEARRQAKEASrph- 131 Anaeromyxobacter sp. Fw109-5
jgi:Desti_2019    93 SMKEARNSFIDLEELSDEELESLQKQFKRLQQRDSSDRGASKEDAere 140 Desulfomonile tiedjei DSM 6799
FDU:OP10G_3693    85 AQSGARNKMIDLEKLTDAQLQRLQQEFDKICNEEEPRTAAGRAQEDTK 132 Fimbriimonas ginsengisoli Gsoil 348
jgi:M446_4617    107 ASA-AQNVYIGIEHLTEEELDSLRARCEARAKSARAAEAADAAQGAAN 153 Methylobacterium sp. 4-46
jgi:Mnod_6107     87 TSA-AQNRYIGIEHLTVEELDELRQRCEARAAKHDEARRAADLAEKAA 133 Methylobacterium nodulans ORS 2060
MSU:OCAR_7479     99 VSA-AQNSFVGIEHLTDAELEEIRIKCETRAEVEKAGERTVEETAVKA 145 Oligotropha carboxidovorans OM5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap