2LJL


Conserved Protein Domain Family
HSP9_HSP12

?
pfam04119: HSP9_HSP12 
Click on image for an interactive view with Cn3D
Heat shock protein 9/12
These heat shock proteins (Hsp9 and Hsp12) are strongly expressed, an increase of 100 fold, upon entry into stationary phase in yeast.
Statistics
?
PSSM-Id: 309303
View PSSM: pfam04119
Aligned: 86 rows
Threshold Bit Score: 59.1382
Threshold Setting Gi: 629660139
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
2LJL_A          1 MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDS 59
gi 685942533  749 gSEPARRDFLDQTRSTMKPDSQKTYTESASDNVKSMSDNVASKMQPEDDKSMPQQAHDS 807
gi 452847104    1 MSDSLRQSNTDKAASALKPDSQKSTLEQVQDSAKSTADSVAGTLQPEGEKSIGQKASDt 59
gi 169852774    1 MSDTGRQSFTDKMGSTMKPDSQKSTMERTGDRMKGTMDSAASSMQPNSQKSTGQQMGDt 59
gi 1030126583   1 MSDALRQSTTDKASSTMKPDSQKSTVESIGDKAKGASDSIAGSIQPEEQKSTTQKATDg 59
gi 631371888    1 MSDTLRQSTADKAEATLKPDSHKSTAESVTDSAKGTADSVAASLQPKGEKSATQKATDt 59
gi 597926122    1 MSDTGRQSLTDKASSAVKPDSQKSMTEQAGDKVKGYADSAASTVQPQGDKSTSQQAGDt 59
gi 353235117    1 MSQTGRQDFTDKVHNAVKPDSQKTFGEQTADWTKGKADTAASTFQPQGNKSTTQKVGDA 59
gi 353235363    1 MSQPGRQDFSDKVHNAVKPDSQKTFTEHIGDMAQGKADSGLSTLQPQQDKSMGQKAGDA 59
gi 302692796    1 MSQAGRQDFTDKAAAAMKPDSQKTATEQVSDYAKGTADSLASTVQPNSEKSGTQRAGDS 59
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap