4DDP,5DFZ


Conserved Protein Domain Family
APG6

?
pfam04111: APG6 
Click on image for an interactive view with Cn3D
Autophagy protein Apg6
In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway.
Statistics
?
Aligned: 130 rows
Threshold Bit Score: 114.927
Threshold Setting Gi: 217410804
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4DDP_A    24 LKKTNVFNATFHIWHS--GQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVP-YGNHSYL- 99  human
EEQ40535 289 LRSLNIYTKLFSISFE--DKWGRINGFRIGY----KVPWPEINVALGQIVQLITFLQKQLSVNLHSYELIP-LGSKSYI- 360 Clavispora lusitani...
CCE44221 292 LRNSNIYKLMFDIKID--DKYGKINGFRIGY----KIVLPEVNAALGQIVLLLTLITKRLDLRLKNYKLVP-MGSQSHI- 363 Candida parapsilosis
EDK45993 352 LRNFNIYKLMFDINLD--EKYGMINGLRIGY----KIVWPEVNAALGQISLLVAFILRRLHLKLEAYKLVP-MGSQSHI- 423 Lodderomyces elongi...
EAZ63927 283 LRSMNIYTKMFSIRFDeqDKYGSINGFRLGY----RIVEPEINAALGQIVMLLMFLTSRLNLKLRHYKLVP-MGSRSQI- 356 Scheffersomyces sti...
EWS71976 173 LNKYNTINSVFFI--EvsEQVGLINNLMIGKKLNEDINWDETNAGLGQVILLFLYLMNKFGYQSSYIKDIQvCGNESYIc 250 Tetrahymena thermop...
EGR28025 164 LNTYNTLNQVFNI--QcdEQAGTINNIIIGKKLNQEIVWDETNAGLGQIAMLFSYLVKKYGYEMKFIKDINlCANESQIc 241 Ichthyophthirius mu...
EEA05788 213 LRKINIFNTTFYI--NqiNGIGTINNLRLGLLDNSDENWREINGALGYTSLLLCCIAEKLNI---EVTLNP-YGNYSTIt 286 Cryptosporidium mur...
Q5CPI7   264 LKRSDFLNLSFYI--QviEGGACINGLRPALFEADFDNWNEVNAALGVSAMLLYTILERHKL---PLSIYP-NGSYSTI- 336 Cryptosporidium parvum
EEY63744 296 AKHLNILTDMFVIGYD--GAFGTINQFRMGQSAGSTLEWNEINAAFGECALLLQTLANMIGLEFPDFRIVP-LGSFSKV- 371 Phytophthora infest...
4DDP_A   100 --ES-------LTDKSKe-------LPLYCS-GGL----RFFWDNKFDHAMVAFLDCVQQFKEEV---EK-----GETRF 150 human
EEQ40535 361 --LKdvvgsndSTGNSPskn--hsvLPLFSS-NEFtlgkLFN-FNKLDVSMMALLDIVSQLELRL---MN-----LDNEL 426 Clavispora lusitani...
CCE44221 364 --VK--------FTDSEdgtrhkkiLNLYSS-DEFtlgrLFN-FNKMDVAMIALLEVVALIEMQL---KR-----IDSEL 423 Candida parapsilosis
EDK45993 424 --VK--------FTKHEdgsrskkiLNLYSS-DEFtlgrLFN-FNKMDVSLIALLEILSIISIKL---RE-----LDTDI 483 Lodderomyces elongi...
EAZ63927 357 --IK-------YSARERtt-----vLNLYSS-DEFslgkLFN-FNKLDVSLITLLDVVAQVEARL---IQ-----IDPDI 412 Scheffersomyces sti...
EWS71976 251 ----------eANKSEQ--------LYLRGPfSNKg------DEAKFNRAMKMILDEFSLFVDYLqqtYL--------QN 298 Tetrahymena thermop...
EGR28025 242 ----------eIEKNQI--------LQLYGPlNYQs------EYSRFDQAIKLLLKEFYCFYEFLinqVKigdyvEEV-- 295 Ichthyophthirius mu...
EEA05788 287 drCIpeylsnfVKEEYSi-------LPLYGNtSANsn---ynQCIKFDSAIKALLSNISNIAKYMncsD----------- 345 Cryptosporidium mur...
Q5CPI7   337 -----------KDSESSi-------WPLHGNtLCNsd---ynECTNFDKGILSFVFLIDTVYNIIpgtNE---------- 385 Cryptosporidium parvum
EEY63744 372 --IR-------TSNLRMe-------YSLHGS-DQQ-----NFAESHFNLGLGAWITCLGQLMAFV---RA-----RDPSI 421 Phytophthora infest...
4DDP_A   151 -CLPYRM--DVEkgKIEDtggsggsYSIKTqfnS-E---EQWTKALKFMLTNLKWGLAWVSS 205 human
EEQ40535 427 -ELPYKIsaKHD--SVGG-------KSIRV---TsN---GQWTEACRYLLIDLNWILAYVSA 472 Clavispora lusitaniae ATCC 42720
CCE44221 424 -ELPYKI--YKD--TIGG-------KSIRV---TaN---SEWTQSCKNLLTCLNWVLTFISA 467 Candida parapsilosis
EDK45993 484 -ELPYKI--KND--SIGG-------KSIRV---TsN---SEWTQSCKLLLTNLNWMLIFVQA 527 Lodderomyces elongisporus NRRL YB-4239
EAZ63927 413 -ELPYKIspHRD--SIGG-------RSIRV---TsK---SEWTQACKFLLTDLNWILSYTSV 458 Scheffersomyces stipitis CBS 6054
EWS71976 299 iQLPFKI--DQSnsSIDGl-----lLTTQTaanAqYkglDNWTQAFKKLLINFKFLISFNAQ 353 Tetrahymena thermophila SB210
EGR28025 296 -KLPYNI--DIQkcEIDY-------VEISImknI-----DLWTSGMKKFLINFKYIIYINEL 342 Ichthyophthirius multifiliis
EEA05788 346 -KLPFII--NYDmnTIDG-------VSYNLlfnD-K---QTWNNAMKMLLINLKYLIINLCE 393 Cryptosporidium muris RN66
Q5CPI7   386 -TLPYSV--DQRngTIGG-------ISLNLlfnEr----ESWNRAMSMNLINLKWLLVRSSE 433 Cryptosporidium parvum
EEY63744 422 -RLPYKV----AkhSIGG-------YSVLFl-kNkQ---KEWTKALKYALTNLKWLLTWVSA 467 Phytophthora infestans T30-4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap