Conserved Protein Domain Family
Peroxin-13_N

?
pfam04088: Peroxin-13_N 
Peroxin 13, N-terminal region
Both termini of the Peroxin-13 are oriented to the cytosol. Peroxin-13 is required for peroxisomal association of peroxin-14.
Statistics
?
PSSM-Id: 309283
View PSSM: pfam04088
Aligned: 90 rows
Threshold Bit Score: 111.088
Threshold Setting Gi: 74896770
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74686346    69 SSLQASTAPAFAVVESLVTAFTSLAQLVESTYLATHSSFFAMVGVADQLGSLKTYLGQVLGVFSILRLGRKILSWLKGK- 147
gi 196008535   43 NRAEDNSRAAFQAIESIVQAFGSVTMMLESTFHAVHSSFRAVLGVAENFNRLRDHFSAILSTFSLIRALRYIYNKLLVLl 122
gi 754348788  218 TRAEESSRTAFQAIENIVQAFGSVSMMLESTFHATYSSFRAVLGVADHFARLRHQLASIFSAIAVFRTVRYIVLRLLRAm 297
gi 156384232   31 RRAEESSQAAFQSVESIVQAFGSIAMMLESTHFAMFNSFRAVIGAADHFSRLKNHLLSAFGAVAIFRTLKYLYQKLLYMl 110
gi 675877172   27 QQAEVSTRQAFQSVETIVRAFGSIAMMLDSTYQAVFNSFRAIIGMADQISRMRLHLSHIFSTLALFRVLRWIVRKVKYFl 106
gi 321464413  134 SMAEESSQPAFQSLESIVHAFGSISMMLDSTLTAVYSSFRAVLGMADQFSRMRTHLSKVFSALAIFRTAKWALHKLFYIf 213
gi 341899768   78 RLAEEQSRGAFQSIESVVNAVSSVANMLNSTHNAVYSSFRAVIGVVEQFGRLKTQLSSVVVSLALFRWAYRFWRWLLVMl 157
gi 308503052   80 RLAEEQSRGAFQSIESVVNAVSSVANMLNSTHNAVYSSFRAVIGVVEQFGRLKTQLSSVVVSLALFRWVYRFWRWLLVMl 159
gi 1005945067 124 RIAEETCGQSFQSLESVVQSVSSVAMMLESTYFAIHSSFRAVLGVAHHLSSLKDQLNQFTEQMPVVRIIISFIKKLLYYl 203
gi 761907753   39 RRAEERTRSAFQSVESVVGAFASVTMMLESTYFAVQSCFRALLGVAQHFSRLKNQIWSILSAITLLRRLQHFLRRLLAIl 118
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 74686346   148 -----------KVKTGPWGEEW-DRIGSSG-----------LPPNGQGGrPSIKPLVIFLLSALGLPYLMSRLV 198
gi 196008535  123 -----------RIRRNNLDEQAwNQAENLGetlgkp---------sqndgPISWPLGLFAVVAIGGPWLIWKII 176
gi 754348788  298 glrspridaqlANISSAMRQERmARAPSVDangnpt---------paspkSKSWPIFLFVAVVFAFPWAIWRLL 362
gi 156384232  111 ----------gLIKTSGLDEEVwTDAATSAasaaaegdakrA--------SRSWPIIMFFAVVMGVPWLIWKFL 166
gi 675877172  107 rr-------lrLGGEVAFNEQLwEDSIRADglkvikdignsSG-------NPTWPIFLFFAIVTGGPWLLWKFF 166
gi 321464413  214 -----------GLRRENPINTAwSTAVSNSdalsagllteaDIKKS----KSSWPITLFLAIIISAPYFIWRII 272
gi 341899768  158 r--------lkPANYASAAEMAwG-SSQPYatdvlgstrtpS--------TVNWPAALFWVVAIGGPWLIYKCV 214
gi 308503052  160 k--------lkPANYASAAEMAwG-ASQPYatdvlgstrtpA--------SVNWPAALFWVVAIGGPWLIYKCV 216
gi 1005945067 204 g--------liSSNSLSDHENAwRQVSSGNihlnsdgtfnpFLSGKDVPnRSSLPILIFFGLVLGAPWMIWSLI 269
gi 761907753  119 -----------RLRAYNQSDELwSDISHSQsaeg------------psqsPRLWPVVMFFTVIVGVPWLLWRLL 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap