Conserved Protein Domain Family
Peroxin-13_N

?
pfam04088: Peroxin-13_N 
Peroxin 13, N-terminal region
Both termini of the Peroxin-13 are oriented to the cytosol. Peroxin-13 is required for peroxisomal association of peroxin-14.
Statistics
?
Aligned: 90 rows
Threshold Bit Score: 113.423
Threshold Setting Gi: 328871590
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPB85092      152 GLTQRMETSTRATFDVIESIVSAFGGFAQMLDSTYMATHSSFMAMVGVAEQFGNLRHYLGGIFSIFALIRWMKRLLYRLT 231 Mucor circinel...
14_pfamImport   1 DFLRIAEETCGQSFQSLESVVQSVSSVAMMLESTYFAIHSSFRAVLGVAHHLSSLKDQLNQFTEQMPVVRIIISFIKKLL 80 
EFP07622       77 NFARLAEEQSRGAFQSIESVVNAVSSVANMLNSTHNAVYSSFRAVIGVVEQFGRLKTQLSSVVVSLALFRWVYRFWRWLL 156 Caenorhabditis...
1_pfamImport    1 NFTRLAEEQSRGAFQSIESVVNAVSSVANMLNSTHNAVYSSFRAVIGVVEQFGRLKTQLSSVVVSLALVRWAYKFWRWLL 80 
EKC18080      140 SIARLAEESSRPAFQSIESIVNAFTSVSMMLDSTFQAMYNSFRAVVGVADNFTRLKSQIGQVLSAFAVFRFLKYLYRKLL 219 Pacific oyster
ESN97686       24 gFAQQAEVSTRQAFQSVETIVRAFGSIAMMLDSTYQAVFNSFRAIIGMADQISRMRLHLSHIFSTLALFRVLRWIVRKVK 103 Helobdella rob...
EDO41172       28 TFVRRAEESSQAAFQSVESIVQAFGSIAMMLESTHFAMFNSFRAVIGAADHFSRLKNHLLSAFGAVAIFRTLKYLYQKLL 107 starlet sea an...
XP_004346731  215 SLTTRAEESSRTAFQAIENIVQAFGSVSMMLESTFHATYSSFRAVLGVADHFARLRHQLASIFSAIAVFRTVRYIVLRLL 294 Capsaspora owc...
EFX75421      131 RFISMAEESSQPAFQSLESIVHAFGSISMMLDSTLTAVYSSFRAVLGMADQFSRMRTHLSKVFSALAIFRTAKWALHKLF 210 common water flea
EDV23223       40 DFLNRAEDNSRAAFQAIESIVQAFGSVTMMLESTFHAVHSSFRAVLGVAENFNRLRDHFSAILSTFSLIRALRYIYNKLL 119 Trichoplax adh...
EPB85092      232 GR-TpppelygpteeqqqlnaeggeQTGALQITENGE-AVEATTTAAa-----gAESGEQQQQQqvarvSRKRPIIIFLA 304 Mucor circinel...
14_pfamImport  81 YYlGl--------------------ISSNSLSDHENAwRQVSSGNIHlnsdgtfNPFLSGKDVPn----RSSLPILIFFG 136
EFP07622      157 VMlKl--------------------KPANYASAAEMAwG-ASQPYATdvlgstrTPA------------SVNWPAALFWV 203 Caenorhabditis...
1_pfamImport   81 VMlRl--------------------KPANYASAAELAwGESSQPYATdilgtsrNPA------------AVNWPAALFWV 128
EKC18080      220 VLl-----------------------RLRPQGYAEEAwSKASDVLSQlpdeggaPK-------------KSTWPIMLFFG 263 Pacific oyster
ESN97686      104 YFlRr-------------------lRLGGEVAFNEQLwEDSIRADGLkvikdigNSSG-----------NPTWPIFLFFA 153 Helobdella rob...
EDO41172      108 YMl----------------------GLIKTSGLDEEVwTDAATSAASaaaegdaKRA------------SRSWPIIMFFA 153 starlet sea an...
XP_004346731  295 RAmGlrspr------------idaqLANISSAMRQERmARAPSVDANgnptpasPK-------------SKSWPIFLFVA 349 Capsaspora owc...
EFX75421      211 YIf-----------------------GLRRENPINTAwSTAVSNSDAlsaglltEADIKKS--------KSSWPITLFLA 259 common water flea
EDV23223      120 VLl-----------------------RIRRNNLDEQAwNQAENLGETlgkpsqnDG-------------PISWPLGLFAV 163 Trichoplax adh...
EPB85092      305 LVTGLPYLMYKLI 317 Mucor circinelloides f. circinelloides 1006PhL
14_pfamImport 137 LVLGAPWMIWSLI 149
EFP07622      204 VAIGGPWLIYKCV 216 Caenorhabditis remanei
1_pfamImport  129 VAIGGPWLIYKCV 141
EKC18080      264 VIMGGPWLIWRMI 276 Pacific oyster
ESN97686      154 IVTGGPWLLWKFF 166 Helobdella robusta
EDO41172      154 VVMGVPWLIWKFL 166 starlet sea anemone
XP_004346731  350 VVFAFPWAIWRLL 362 Capsaspora owczarzaki ATCC 30864
EFX75421      260 IIISAPYFIWRII 272 common water flea
EDV23223      164 VAIGGPWLIWKII 176 Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap