Conserved Protein Domain Family
Peroxin-13_N

?
pfam04088: Peroxin-13_N 
Peroxin 13, N-terminal region
Both termini of the Peroxin-13 are oriented to the cytosol. Peroxin-13 is required for peroxisomal association of peroxin-14.
Statistics
?
PSSM-Id: 309283
View PSSM: pfam04088
Aligned: 90 rows
Threshold Bit Score: 111.088
Threshold Setting Gi: 74896770
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5KKC0        69 SSLQASTAPAFAVVESLVTAFTSLAQLVESTYLATHSSFFAMVGVADQLGSLKTYLGQVLGVFSILRLGRKILSWLKGK- 147 Cryptococcus ne...
XP_002114133  43 NRAEDNSRAAFQAIESIVQAFGSVTMMLESTFHAVHSSFRAVLGVAENFNRLRDHFSAILSTFSLIRALRYIYNKLLVLl 122 Trichoplax adha...
XP_004346731 218 TRAEESSRTAFQAIENIVQAFGSVSMMLESTFHATYSSFRAVLGVADHFARLRHQLASIFSAIAVFRTVRYIVLRLLRAm 297 Capsaspora owcz...
XP_001633235  31 RRAEESSQAAFQSVESIVQAFGSIAMMLESTHFAMFNSFRAVIGAADHFSRLKNHLLSAFGAVAIFRTLKYLYQKLLYMl 110 starlet sea ane...
XP_009024146  27 QQAEVSTRQAFQSVETIVRAFGSIAMMLDSTYQAVFNSFRAIIGMADQISRMRLHLSHIFSTLALFRVLRWIVRKVKYFl 106 Helobdella robusta
EFX75421     134 SMAEESSQPAFQSLESIVHAFGSISMMLDSTLTAVYSSFRAVLGMADQFSRMRTHLSKVFSALAIFRTAKWALHKLFYIf 213 common water flea
EGT55703      78 RLAEEQSRGAFQSIESVVNAVSSVANMLNSTHNAVYSSFRAVIGVVEQFGRLKTQLSSVVVSLALFRWAYRFWRWLLVMl 157 Caenorhabditis ...
XP_003113710  80 RLAEEQSRGAFQSIESVVNAVSSVANMLNSTHNAVYSSFRAVIGVVEQFGRLKTQLSSVVVSLALFRWVYRFWRWLLVMl 159 Caenorhabditis ...
XP_015795872 124 RIAEETCGQSFQSLESVVQSVSSVAMMLESTYFAIHSSFRAVLGVAHHLSSLKDQLNQFTEQMPVVRIIISFIKKLLYYl 203 two-spotted spi...
XP_011403426  39 RRAEERTRSAFQSVESVVGAFASVTMMLESTYFAVQSCFRALLGVAQHFSRLKNQIWSILSAITLLRRLQHFLRRLLAIl 118 Amphimedon quee...
Q5KKC0       148 -----------KVKTGPWGEEW-DRIGSSG-----------LPPNGQGGrPSIKPLVIFLLSALGLPYLMSRLV 198 Cryptococcus neoformans
XP_002114133 123 -----------RIRRNNLDEQAwNQAENLGetlgkp---------sqndgPISWPLGLFAVVAIGGPWLIWKII 176 Trichoplax adhaerens
XP_004346731 298 glrspridaqlANISSAMRQERmARAPSVDangnpt---------paspkSKSWPIFLFVAVVFAFPWAIWRLL 362 Capsaspora owczarzaki...
XP_001633235 111 ----------gLIKTSGLDEEVwTDAATSAasaaaegdakrA--------SRSWPIIMFFAVVMGVPWLIWKFL 166 starlet sea anemone
XP_009024146 107 rr-------lrLGGEVAFNEQLwEDSIRADglkvikdignsSG-------NPTWPIFLFFAIVTGGPWLLWKFF 166 Helobdella robusta
EFX75421     214 -----------GLRRENPINTAwSTAVSNSdalsagllteaDIKKS----KSSWPITLFLAIIISAPYFIWRII 272 common water flea
EGT55703     158 r--------lkPANYASAAEMAwG-SSQPYatdvlgstrtpS--------TVNWPAALFWVVAIGGPWLIYKCV 214 Caenorhabditis brenneri
XP_003113710 160 k--------lkPANYASAAEMAwG-ASQPYatdvlgstrtpA--------SVNWPAALFWVVAIGGPWLIYKCV 216 Caenorhabditis remanei
XP_015795872 204 g--------liSSNSLSDHENAwRQVSSGNihlnsdgtfnpFLSGKDVPnRSSLPILIFFGLVLGAPWMIWSLI 269 two-spotted spider mite
XP_011403426 119 -----------RLRAYNQSDELwSDISHSQsaeg------------psqsPRLWPVVMFFTVIVGVPWLLWRLL 169 Amphimedon queenslandica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap