Conserved Protein Domain Family
FeS

?
pfam04060: FeS 
Putative Fe-S cluster
This family includes a domain with four conserved cysteines that probably form an Fe-S redox cluster.
Statistics
?
Aligned: 394 rows
Threshold Bit Score: 28.1682
Threshold Setting Gi: 389312964
Created: 19-Jun-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Hprae_1240   45 LPGVNCGACGYAGCSAFAEAVAAGEA-PVNGCPV 77  Halanaerobium praevalens DSM 2228
jgi:Amet_2285    46 LPSANCGACGYPGCEAFAKAIVEGKA-PIEGCPV 78  Alkaliphilus metalliredigens QYMF
jgi:Dtur_1096    44 LPGANCGACGYPGCEGFAKAVVEGRA-PYTGCVV 76  Dictyoglomus turgidum DSM 6724
jgi:TepRe1_1881  45 LPGANCGACGYPGCSGLAKAIVEGKA-PVNTCPV 77  Tepidanaerobacter acetatoxydans Re1
jgi:Tlet_0291    43 LPGANCGACGYAGCEAYAKAVVAGKA-TFDMCIP 75  Pseudothermotoga lettingae TMO
jgi:Theth_1276   44 LPGANCGACGYPGCDGFAKAVVAGKA-TPDMCLP 76  Pseudothermotoga thermarum DSM 5069
CDD23484         44 LPGANCGACTYPGCSGLADALIEGKVtHVKQCKV 77  Firmicutes bacterium CAG:345
CCU83679         46 LPGANCGACGFPGCAAFAKAVAEGKA-PIEGCIP 78  Mesotoga infera
CCZ94906         58 LAGSNCGACGHPGCAGFAKALVEGTA-KLDSCgq 90  Corallococcus sp. CAG:1435
CDD10550         53 LSGANCGACGYAGCDGFATALVEGKA-ELSSCNa 85  Clostridium sp. CAG:349
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap