4WFQ


Conserved Protein Domain Family
Ssl1

?
pfam04056: Ssl1 
Click on image for an interactive view with Cn3D
Ssl1-like
Ssl1-like proteins are 40kDa subunits of the Transcription factor II H complex.
Statistics
?
PSSM-Id: 309257
View PSSM: pfam04056
Aligned: 6 rows
Threshold Bit Score: 298.957
Threshold Setting Gi: 26400388
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WFQ_A       11 TLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNP 90
gi 74948288  67 VLDCSESMSVPDLKPTRLRCTVKLLELFIEEFFDQNPISQLGLIALKAKRAEKVTELTGTSRVHLKALESLANVSLTSEP 146
gi 18203119  64 VVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEP 143
gi 27923998  68 VIDCSRFMTSKAMPPSRFVVVMKALQTFLDRFFEQNPIAQIGLITCKDRKADRLTMMTGNIRVLKESLNTLTEAFCGGDF 147
gi 75217012  87 VIDFSRAAAEMDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGGSPETHIKALMGKL--EALGDS 164
gi 26400388  92 VLDLSNSMEERDFHHKRFDLQIKYASEFVLEFFEQNPISQLSIIGVMDGIAHRITDLHGNPQSHIQKLKSLR--DCSGNF 169
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WFQ_A       91 SLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNyGdesFY 170
gi 74948288 147 SLQNGLDLALKSLKVVPSHASREIVIIMGSLTTCDPVDINLTIDELKKEGIRCSVISLSAEIHVARYLTQQTM-G---TF 222
gi 18203119 144 SLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETG-G---TY 219
gi 27923998 148 SLQNALQLACANLKGMPGHVSREVVLVISALSTIDPGNIYSTIETMKRMNIRCSAIGLSAEMFVCKEMAKATK-G---EY 223
gi 75217012 165 SLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIMETIQKCKKSKLRCSVIGLSAEMFICKHLCQETG-G---LY 240
gi 26400388 170 SLQNALEMARASLSHIASHGTREVLIIFGSILSSDPGDIFKTIDALVHDSIRVRIVGLAAEVAICKEICNKTNsStknAY 249
                       170       180
                ....*....|....*....|..
4WFQ_A      171 KILLDETHLKELFNEAVTPLPV 192
gi 74948288 223 GAVLDDAHFRDQLMSQVDPPPA 244
gi 18203119 220 HVILDETHYKELLAHHVSPPPA 241
gi 27923998 224 SVALDPDHLQLLFSKHTLPPSS 245
gi 75217012 241 SVAVDEVHLKDLLLEHAPPPPA 262
gi 26400388 250 GVVISEQHFRELLLESTIPPAT 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap