4WFQ


Conserved Protein Domain Family
Ssl1

?
pfam04056: Ssl1 
Click on image for an interactive view with Cn3D
Ssl1-like
Ssl1-like proteins are 40kDa subunits of the Transcription factor II H complex.
Statistics
?
PSSM-Id: 309257
View PSSM: pfam04056
Aligned: 6 rows
Threshold Bit Score: 298.957
Threshold Setting Gi: 26400388
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WFQ_A  11 TLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNP 90  Saccharomyces cerevis...
Q9VNP8  67 VLDCSESMSVPDLKPTRLRCTVKLLELFIEEFFDQNPISQLGLIALKAKRAEKVTELTGTSRVHLKALESLANVSLTSEP 146 fruit fly
Q9JIB4  64 VVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEP 143 house mouse
P34567  68 VIDCSRFMTSKAMPPSRFVVVMKALQTFLDRFFEQNPIAQIGLITCKDRKADRLTMMTGNIRVLKESLNTLTEAFCGGDF 147 Caenorhabditis elegans
Q9ZVN9  87 VIDFSRAAAEMDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGGSPETHIKALMGKL--EALGDS 164 thale cress
O74995  92 VLDLSNSMEERDFHHKRFDLQIKYASEFVLEFFEQNPISQLSIIGVMDGIAHRITDLHGNPQSHIQKLKSLR--DCSGNF 169 Schizosaccharomyces p...
4WFQ_A  91 SLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNyGdesFY 170 Saccharomyces cerevis...
Q9VNP8 147 SLQNGLDLALKSLKVVPSHASREIVIIMGSLTTCDPVDINLTIDELKKEGIRCSVISLSAEIHVARYLTQQTM-G---TF 222 fruit fly
Q9JIB4 144 SLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETG-G---TY 219 house mouse
P34567 148 SLQNALQLACANLKGMPGHVSREVVLVISALSTIDPGNIYSTIETMKRMNIRCSAIGLSAEMFVCKEMAKATK-G---EY 223 Caenorhabditis elegans
Q9ZVN9 165 SLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIMETIQKCKKSKLRCSVIGLSAEMFICKHLCQETG-G---LY 240 thale cress
O74995 170 SLQNALEMARASLSHIASHGTREVLIIFGSILSSDPGDIFKTIDALVHDSIRVRIVGLAAEVAICKEICNKTNsStknAY 249 Schizosaccharomyces p...
4WFQ_A 171 KILLDETHLKELFNEAVTPLPV 192 Saccharomyces cerevisiae S288c
Q9VNP8 223 GAVLDDAHFRDQLMSQVDPPPA 244 fruit fly
Q9JIB4 220 HVILDETHYKELLAHHVSPPPA 241 house mouse
P34567 224 SVALDPDHLQLLFSKHTLPPSS 245 Caenorhabditis elegans
Q9ZVN9 241 SVAVDEVHLKDLLLEHAPPPPA 262 thale cress
O74995 250 GVVISEQHFRELLLESTIPPAT 271 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap