5AP8


Conserved Protein Domain Family
Ribo_biogen_C

?
pfam04034: Ribo_biogen_C 
Click on image for an interactive view with Cn3D
Ribosome biogenesis protein, C-terminal
This family represents the C-terminal domain of some putative ribosome biogenesis proteins in archaea. It has also been identified in the eukaryotic protein Tsr3, which is involved in ribosomal RNA biogenesis.
Statistics
?
PSSM-Id: 335587
View PSSM: pfam04034
Aligned: 196 rows
Threshold Bit Score: 133.321
Threshold Setting Gi: 383795715
Created: 18-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5AP8_A         36 VVLDPFAQITLSNKDKDIVRRiGITIVDTSWNNTS---QSEfkn---irgE--HRRIPILFAGNPIHYGIAYKLSSIEAL 107
gi 74567924    44 IVLTPYSEIYLNNKDSGLYSAyGLCILETSWNSIN---DISrir----plN--ARRLPLLLPVNPVNYGRPGKLSSVEAA 114
gi 530560787   49 lsLTPFADVFVTPADSAIILErGISVIDGSWARIE---GIrnl----rmrF--PRKLPLLVPANPVNFGKPGKLSSVEAI 119
gi 530555069   46 LVLTVSSSQYLMNSDRTLILErGITAIEGSWKQNNlmgETKf-------rY--GRILPPLLASNPVNYGKWNLLSSVEAI 116
gi 408364604   38 IVLNPFSRTPVTKNDSATADS--VCAIDCSWERAD---EVLksqrlisqgI--GRRLPAMLAANPTNYAKLGKLSSAEAL 110
gi 304377067   42 ILLNPIASSYLKRSDRIYIEScGIVAIDISWKQ-S---LYLlrka--lsmHtkNRVLPILIAANPINYGKPFKLSTAEAI 115
gi 118194926   38 ILLDPFAPRVLLPPDAGLg---PVTCIDCSWKKAG---ESFapgm-----pgtRRRLPPLLAGNPVNYSRQNMLSTAEAL 106
gi 1114650055  39 VVLRYDADRTLLPDDRSAVERkGICIIEGSWNLGD---Llgsy----rkgI--ERKLPVLMAGNPVNFGKFNKLSSVEAV 109
gi 530554177   41 IVLYPDSAVRLSPEDSSLq---HLVAIDVSWENIG---SYHfpl-------ksaRSLPYMLAANPVNYGKPYKLSTVEAI 107
gi 160339426   38 LVLDPFSKNTLMSKDKSLINS--IVGIDCSWNLAD---QAFskk---fngI--KRKLPPLLAGNPVNYAKLNKLTTVEAL 107
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
5AP8_A        108 IATLYIVDEVEEAIKLSNVVKWGHTFIELNKELLEAYKN-KTEEDIKKIEREI 159
gi 74567924   115 AAALYILGRHDEASKILEKFSWAQTFLSVNMMPLSDYERcRTQEDIKKTEDMY 167
gi 530560787  120 AAALYICGFRSSSTLVLSKFNWGMQFLKVNMEPLEEYSScSSQEDVTKAESLF 172
gi 530555069  117 SASLIITGFRDFAERILSKFSWGHSFISLNMEILEEYAKcKSEDDIKNVVDSI 169
gi 408364604  111 AGALYILGEKKLAAELMDKFKWGHTFLELNSSLLEDYANaDTKEQVEQLEKEY 163
gi 304377067  116 AASLFITGFIEEANAILNEFKWGPQFLELNRYRLERYSQaDSDEELDKIQKEl 168
gi 118194926  107 AAALYILGRRARAEEMMDKFRWGHTFLELNRNLLDEYASmRDESEIGPVLREY 159
gi 1114650055 110 VGALFITGHIDQAKVMIGKFTWGHTFIELNMELFKSYSAcQTMEDLENVylef 162
gi 530554177  108 AASYYIMGMKDVAVSLLGKFTWGIQFINLNENPLNDYSKaRSSSEIKEIEKLY 160
gi 160339426  108 AASLFILGQKEQGLELLEKFKWGHTFYELNQNLFDEYLKlENEEQIELILKDY 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap