Conserved Protein Domain Family
FlgD

?
pfam03963: FlgD 
Flagellar hook capping protein - N-terminal region
FlgD is known to be absolutely required for hook assembly, yet it has not been detected in the mature flagellum. It appears to act as a hook-capping protein to enable assembly of hook protein subunits. FlgD regulates the assembly of the hook cap structure to prevent leakage of hook monomers into the medium and hook monomer polymerization and also plays a role in determination of the correct hook length, with the help of the FliK protein. This family represents the N-terminal conserved region of FlgD. A recent crystal structure showed that this region was likely to be flexible and was cleaved off during crystallisation.
Statistics
?
PSSM-Id: 309186
View PSSM: pfam03963
Aligned: 54 rows
Threshold Bit Score: 38.4384
Threshold Setting Gi: 81563617
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6NA81         9 TTPYSApnPNYSADSAKSKTSSTPGIADNFQTFLTLLTTQLKNQNPTDPLDTNQFTQQLVQFAGIEQQLKTNDSLSS 85  Rhodopseudomonas p...
WP_013568357   9 QHPTAS--AASAMDTSTNPTTATSNDTITSDDFMTLLVAEMQNQDPTAPSDPTQYIQQLVGVNSLQQLIGINTGIGe 83  Terriglobus saanensis
WP_014785694  11 TQQTAR--VSAYASSASSNSSADDATTITSSDFLTLLVTQMKNQDPTEPTDPSQYLQQLVGVNSLEQLIDVNKQLTS 85  Terriglobus roseus
CCZ78387      10 NWASVE--NGKVKTTTSKKSDESNNGTMGYDQFLTLLCAEMQYQDPLEPTSNTEYVAQLATFSQLEAMLGMQDTQkn 84  Roseburia sp. CAG:18
CDE35458      13 TSSTTE--STTISSKSTKEKDAKESSTLDVNDFLSLLVTEMQYQDPLEPTDNSQYIAQMATFSQVEATKEM---LDT 84  Eubacterium sp. CA...
CBK74811      19 aASQEA--TKSNSTTSTSKTAESKGTQYNQEMFLQLLVAEMQYQDPLEPTDNGQYVAQLASFTQIEAIQSVQNDMAT 93  Butyrivibrio fibri...
WP_012706882   8 SSASAS--TTSTTSTTSTSSTDAADATLNYQSFLKLLIAQMQNQDPTDPMDATEQISQLATFSQVEQSIKTNSNLES 82  Sinorhizobium fredii
WP_003529859   6 vnNTSN--SYTPTVSATDSAGDASAATLNYESFLKLLVAQMKNQDPTQPMDATQQIAQLATFSQVEQTIKTNKNLES 80  Sinorhizobium meli...
WP_023919475   6 NTNTSS--NTSSSSSSRTSSSTATSVSSDYQMFLKLLTTQMTNQDPTSPMDSADYAVQLATFSQVEQQVKTNTLLTS 80  Rhodobacter capsul...
WP_012336145  10 TAGASS--GATATGGSAAPTTSKTATSLNTDAFLQLLLTQLKNQDPTKPMDSTAYMGELATFSEVEQSTKMNNKLDA 84  Methylobacterium s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap