2G0C


Conserved Protein Domain Family
DbpA

?
pfam03880: DbpA 
Click on image for an interactive view with Cn3D
DbpA RNA binding domain
This RNA binding domain is found at the C-terminus of a number of DEAD helicase proteins. It is sufficient to confer specificity for hairpin 92 of 23S rRNA, which is part of the ribosomal A-site. However, several members of this family lack specificity for 23S rRNA. These can proteins can generally be distinguished by a basic region that extends beyond this domain [Karl Kossen, unpublished data].
Statistics
?
PSSM-Id: 335515
View PSSM: pfam03880
Aligned: 614 rows
Threshold Bit Score: 33.8857
Threshold Setting Gi: 504212082
Created: 21-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2G0C_A         2 KLYFNGGKKKKIRAVDFVGTIAKIDGVSA-DDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNK 73  Bacillus subtilis
Q2LY23       470 PLFINAGKKDGISPKRLMRDLSDAAGMPD-VRIGRIEVNNTTSLLEADSRFAPKILQALKSLTINGRYVAVEI 541 Syntrophus aciditrophi...
WP_014269797 115 TLYLNIGKMKRLYAKELSQLLQTELGVTR-EEIFSIRIHDKYSFISMSEENCEKAIATLNGMDIKGRTAAVSy 186 Sphaerochaeta pleomorpha
WP_013738919 118 TLYLNIGKMKRLHAKDLSVLLQEKLGITR-EDILSIRIHDKYTFIAMKEEHCEKAIELLNGIDINGRTVAISy 189 Sphaerochaeta coccoides
WP_013253079 425 TLFVSIGKNRKVYPKDLVYLFRSTLSLKK-AEIGSVKVLDNYSFVEISELRSQEAISKMDGMEYRGRKITVNy 496 Spirochaeta smaragdinae
WP_013314446 414 dIFFSMGKNRKIFPEDLKELVLSVEGLTE-EDIGEIRVLDNYSFVEVSEPFAEKVISTLNGTDFKGKRLTVny 485 Spirochaeta thermophila
WP_015706742 120 RIFISIGRNRRVFPREILGLIGTKTQISK-DDIGLINILNNYSFIQVRTSVAEELITALNGVNFRGRTLTVNH 191 Treponema primitia
CDB55562     469 TLFMNGGRMIGLRPKDIAGLFYNTVEMEK-GAVGDIRIFPKHSLIEVDASVAPLLLEALATATVCGYEVNVRE 540 Akkermansia muciniphil...
WP_013345264 368 TLMVNAGRRARLRKGDLMGALIKAAGVPA-DAIVAIELMPDHSYVTLSKRYVATALAALDGGEVKGKPVKVRP 439 Ferrimonas balearica
WP_023792735 464 eICINLGSEDNINKEDIIKYLMDT-GIVKeDQIKKIRIINRRSYVKLSADCSPELLTALHQRTLKGLKARVNl 535 delta proteobacterium ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap