2M1S


Conserved Protein Domain Family
zf-P11

?
pfam03854: zf-P11 
Click on image for an interactive view with Cn3D
P-11 zinc finger
Statistics
?
PSSM-Id: 281801
View PSSM: pfam03854
Aligned: 3 rows
Threshold Bit Score: 82.9869
Threshold Setting Gi: 75569451
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2M1S_A 27 GPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLR 76  Lassa virus Josiah
Q88470 36 GRYNCKCCWFADKNLITCSDHYLCLRCHQIMLRNSELCNICWKPLPTSIR 85  Tacaribe virus strain Franze-Fernandez
P18541 28 GPLSCKSCWQKFDSLVRCHDHYLCRHCLNLLLSVSDRCPLCKYPLPTRLK 77  Lymphocytic choriomeningitis virus (strain Armstrong)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap