Conserved Protein Domain Family
TehB

?
pfam03848: TehB 
Tellurite resistance protein TehB
Statistics
?
Aligned: 4 rows
Threshold Bit Score: 359.152
Threshold Setting Gi: 135581
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZC59  98 FYCQPEDFYHKKYNLTPTHSEVIEAVKTVKPGKALDLGCGSGRNSLYLNLLGFDVTAVDKNNDSIGNLQQIIDKEALKGI 177 Yersinia pestis
P25397   1 MIIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNL 80  Escherichia coli K-12
P45134  91 FYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLN-I 169 Haemophilus influenza...
Q9CMZ4  91 FHCKKKDYFHKKYNMTPTHSEVKSAVEILSPCKVLDLGCGQGRNSLFLSLLGYNVTAWDHNENSIKFLQDTAEKENLT-I 169 Pasteurella multocida
Q9ZC59 178 TASSYNINEASLDERYDFILSTVVLMFLQPERIPHIISNMQECTLPGGYNLIISAMSTDDFPCTVPFSFTFQSGELKDYY 257 Yersinia pestis
P25397  81 HTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYY 160 Escherichia coli K-12
P45134 170 STALYDINAANIQENYDFIVSTVVFMFLNRERVPSIIKNMKEHTNVGGYNLIVAAMSTDDVPCPLPFSFTFAENELKEYY 249 Haemophilus influenza...
Q9CMZ4 170 QTALYDINSAKISENYDFILSTVVFMFLKPQCISQIIENMQTHTNVGGYNLIVAAMSTEEVPCPVPFSFTFKENELKTYY 249 Pasteurella multocida
Q9ZC59 258 QDWAILKYNEDVGQLHKTDAQGNRIKLRFATLL 290 Yersinia pestis
P25397 161 EGWERVKYNEDVGELHRTDANGNRIKLRFATML 193 Escherichia coli K-12
P45134 250 KDWEFLEYNENMGELHKTDENGNRIKMKFATML 282 Haemophilus influenzae Rd KW20
Q9CMZ4 250 QDWELVKYNEEMGELHKTDENGNRIKMKFVTML 282 Pasteurella multocida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap