2XVA,3M70


Conserved Protein Domain Family
TehB

?
pfam03848: TehB 
Click on image for an interactive view with Cn3D
Tellurite resistance protein TehB
Statistics
?
PSSM-Id: 281796
View PSSM: pfam03848
Aligned: 4 rows
Threshold Bit Score: 342.214
Threshold Setting Gi: 295982502
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XVA_B        3 MVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNL 82
gi 81859397  98 FYCQPEDFYHKKYNLTPTHSEVIEAVKTVKPGKALDLGCGSGRNSLYLNLLGFDVTAVDKNNDSIGNLQQIIDKEALKGI 177
3M70_A       91 FYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLN-I 169
gi 81856755  91 FHCKKKDYFHKKYNMTPTHSEVKSAVEILSPCKVLDLGCGQGRNSLFLSLLGYNVTAWDHNENSIKFLQDTAEKENLT-I 169
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XVA_B       83 HTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYY 162
gi 81859397 178 TASSYNINEASLDERYDFILSTVVLMFLQPERIPHIISNMQECTLPGGYNLIISAMSTDDFPCTVPFSFTFQSGELKDYY 257
3M70_A      170 STALYDINAANIQENYDFIVSTVVFXFLNRERVPSIIKNXKEHTNVGGYNLIVAAXSTDDVPCPLPFSFTFAENELKEYY 249
gi 81856755 170 QTALYDINSAKISENYDFILSTVVFMFLKPQCISQIIENMQTHTNVGGYNLIVAAMSTEEVPCPVPFSFTFKENELKTYY 249
                       170       180       190
                ....*....|....*....|....*....|...
2XVA_B      163 EGWERVKYNEDVGELHRTDANGNRIKLRFATML 195
gi 81859397 258 QDWAILKYNEDVGQLHKTDAQGNRIKLRFATLL 290
3M70_A      250 KDWEFLEYNENXGELHKTDENGNRIKXKFATXL 282
gi 81856755 250 QDWELVKYNEEMGELHKTDENGNRIKMKFVTML 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap