1H3O


Conserved Protein Domain Family
TFIID_20kDa

?
pfam03847: TFIID_20kDa 
Click on image for an interactive view with Cn3D
Transcription initiation factor TFIID subunit A
Statistics
?
PSSM-Id: 112650
View PSSM: pfam03847
Aligned: 8 rows
Threshold Bit Score: 85.8834
Threshold Setting Gi: 74948407
Created: 16-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1H3O_B   7 TKKKLQDLVREV-----DPNEQLDEDVEEXLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWN 73  human
Q03761 416 SKRKLRELVKTVgidegDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWN 487 Saccharomyces cerevisiae S288c
P49905  93 TKPRLTELVREV-----DTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYN 159 fruit fly
Q9VR21  67 SKTNMLQFVQKI-----DANSSLDDQGCDMMARIADAFVNDISMRIVKLAKYRKSD-VSVLDLKFILKREFN 132 fruit fly
Q9U226 230 eksKLDDLMQQI-----SSTTVLEENVKDVLVEYADDFVSSLIDKACKMIKNREVKKIESRDIEFILKNVYN 296 Caenorhabditis elegans
Q9SR71 401 GKRSIHELLQQI-----DPSEKLDPEVEDILSDIAEDFVESITTFGCSLAKHRKSDILEAKDILLHVERNWN 467 thale cress
Q940A7 529 GKRKIQDLVSQV-----DVHAKLDPDVEDLLLEVADDFIDSVTSFACSLAKHRKSSVLEPKDILLHLEKNLH 595 thale cress
O13722 344 SKRKLHDLLQQI-----DSEEKIEPEVEELLLEIADEFVESVTNFACRLAKHRKSDTLDVRDVQLHLERNWN 410 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap