2EFG,3JB9


Conserved Protein Domain Family
EFG_IV

?
pfam03764: EFG_IV 
Click on image for an interactive view with Cn3D
Elongation factor G, domain IV
This domain is found in elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopts a ribosomal protein S5 domain 2-like fold.
Statistics
?
PSSM-Id: 281721
View PSSM: pfam03764
Aligned: 67 rows
Threshold Bit Score: 98.4273
Threshold Setting Gi: 6919883
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EFG_A 479 PQVAYRETITKPVD-VEGKFIRQTGGRGQYGHVKIKVEPLPrGSGFEFVNAIV----GGVIPKEYIPAVQKGIEEAMQSG 553  Thermus thermophilus...
3JB9_B 717 GKVNIN----WPQKrISEFFQKNYDWDLLASRSIWAFGPDD-RGTNILRDDTLstdvDKNVLNSVKEYIKQGFQWGTREG 791  Schizosaccharomyces ...
P30925 511 GTIRED----MDSKeMAKILRDEASWDYDEAKRIIAIDEN----VNVFVDLTS----GVQHLREVMDTVLQGFRLAMKEG 578  Sulfolobus solfatari...
Q9YC19 510 GAVTED----QDPKdRARILADKAGWDYNEARKIWAIDEN----INVFVDKTAg----VQYLREVKDTIIAGFRLALKEG 577  Aeropyrum pernix K1
P26752 505 GDIPQGS-KFKDKKaLVELLVS-KGIDRDEAKGLVCVEG-----TNMMFDVTRg----IQYLDETMELLIEAFVEVMNRG 573  Thermoplasma acidoph...
Q58448 508 GRIPDVDTKRKLDDkIVQELIK-AGMDPEEAKRVMCIYE-----GNVLINMTRg----IVHLDEVKELIIQGFKEAMRNG 577  Methanocaldococcus j...
O27131 506 GKIKEG--RVKG-KeMAKNFIE-AGMDKEEARRVWDVYE-----KNLFINMTRg----IQYLDEIKELLMDGFESAMDNG 572  Methanothermobacter ...
O28385 504 GVVDMK----MDKKeRRRLLQE-AGLTSEEAAGAEEYYE-----GNLFCDVTKg----IQYLNETMELILEGFREAMRAG 569  Archaeoglobus fulgid...
O93632 506 DEISMR----MPEVeRREKLMA-AGLNKDEAKKIVNIFE-----SNAYFDMTKg----IQYLNETMELIIEGFTEVMKAG 571  Methanococcoides bur...
Q8TRC3 506 geVSMN----LPELeRRQKLID-LGMEKEEAKGIVGIFN-----SNIFIDMTK----GIQYLNETMELVLDGFEEVMRAG 571  Methanosarcina aceti...
2EFG_A 554 PLIGFPVVDIKVTLYDGSYHE--VDSSEMAFKIAGSMAIKEAVQKG 597  Thermus thermophilus HB8
3JB9_B 792 PLCDETIRNVNFRLMDVVLAPeqIYRGGGQIIPTARRVCYSSFLTA 837  Schizosaccharomyces pombe 972h-
P30925 579 PLAHEPIRGVKVILHDAVIHEdpAHRGPAQIYPAVRNSIFAGFLTS 624  Sulfolobus solfataricus P2
Q9YC19 578 PLAAEPVRGVKVVLHDAVIHEdpVHRGPGQLYPAVRNAIWAGILDG 623  Aeropyrum pernix K1
P26752 574 PLANEKVFGVKARLVDAKLHEdsIHRGPAQVIPAGRNSIYGAMCEA 619  Thermoplasma acidophilum DSM 1728
Q58448 578 PLAAEKCQGVKVKLMDAVLHEdaIHRGPAQMIPAARFGIRDAMMQA 623  Methanocaldococcus jannaschii DSM 2661
O27131 573 PVAKEKVMGVKIKLMDAKIHEdaVHRGPAQVLPAIRKGIFGAMMSA 618  Methanothermobacter thermautotrophicus str. Delta H
O28385 570 PIAREPCMGIKVKLVDCKLHEdaVHRGPAQVIPAVRSAIFAAILQA 615  Archaeoglobus fulgidus DSM 4304
O93632 572 PLSKEPCMGVKVKLMDAKLHEdaVHRGPAQVIPASRQAIQAAMLMA 617  Methanococcoides burtonii DSM 6242
Q8TRC3 572 PLTREPVANVKCVLVDAKLHEdaIHRGPAQIIPAARQAIQAGMLMA 617  Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap