4FN5,1N0V,3J36,3JB9


Conserved Protein Domain Family
EFG_IV

?
pfam03764: EFG_IV 
Click on image for an interactive view with Cn3D
Elongation factor G, domain IV
This domain is found in elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopts a ribosomal protein S5 domain 2-like fold.
Statistics
?
Aligned: 70 rows
Threshold Bit Score: 97.648
Threshold Setting Gi: 6919883
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4FN5_A 489 PQVAYRETITKDNVeIEGKFVRQSGGRGQFGHCWIRFsaadvdEKGNiTEGLVFENEVV----GGVVPKEYIPAIQKGIE 564  Pseudomonas aerugino...
O94316 717 GKVNIN----WPQKrISEFFQKNYDWDLLASRSIWAF------GPDD-RGTNILRDDTLstdvDKNVLNSVKEYIKQGFQ 785  Schizosaccharomyces ...
P30925 511 GTIRED----MDSKeMAKILRDEASWDYDEAKRIIAI------DEN----VNVFVDLTS----GVQHLREVMDTVLQGFR 572  Saccharolobus solfat...
Q9YC19 510 GAVTED----QDPKdRARILADKAGWDYNEARKIWAI------DEN----INVFVDKTAg----VQYLREVKDTIIAGFR 571  Aeropyrum pernix K1
P26752 505 GDIPQGS-KFKDKKaLVELLVS-KGIDRDEAKGLVCV------EG-----TNMMFDVTRg----IQYLDETMELLIEAFV 567  Thermoplasma acidoph...
Q58448 508 GRIPDVDTKRKLDDkIVQELIK-AGMDPEEAKRVMCI------YE-----GNVLINMTRg----IVHLDEVKELIIQGFK 571  Methanocaldococcus j...
O27131 506 GKIKEG--RVKG-KeMAKNFIE-AGMDKEEARRVWDV------YE-----KNLFINMTRg----IQYLDEIKELLMDGFE 566  Methanothermobacter ...
O28385 504 GVVDMK----MDKKeRRRLLQE-AGLTSEEAAGAEEY------YE-----GNLFCDVTKg----IQYLNETMELILEGFR 563  Archaeoglobus fulgid...
O93632 506 DEISMR----MPEVeRREKLMA-AGLNKDEAKKIVNI------FE-----SNAYFDMTKg----IQYLNETMELIIEGFT 565  Methanococcoides bur...
Q8TRC3 506 geVSMN----LPELeRRQKLID-LGMEKEEAKGIVGI------FN-----SNIFIDMTK----GIQYLNETMELVLDGFE 565  Methanosarcina aceti...
4FN5_A 565 EQMKNGVVAGYPLIGLKATVFDGSYHD--VDSNEMAFKIAASMATKQLAQKGG 615  Pseudomonas aeruginosa PAO1
O94316 786 WGTREGPLCDETIRNVNFRLMDVVLAPeqIYRGGGQIIPTARRVCYSSFLTAS 838  Schizosaccharomyces pombe 972h-
P30925 573 LAMKEGPLAHEPIRGVKVILHDAVIHEdpAHRGPAQIYPAVRNSIFAGFLTSR 625  Saccharolobus solfataricus P2
Q9YC19 572 LALKEGPLAAEPVRGVKVVLHDAVIHEdpVHRGPGQLYPAVRNAIWAGILDGR 624  Aeropyrum pernix K1
P26752 568 EVMNRGPLANEKVFGVKARLVDAKLHEdsIHRGPAQVIPAGRNSIYGAMCEAK 620  Thermoplasma acidophilum DSM 1728
Q58448 572 EAMRNGPLAAEKCQGVKVKLMDAVLHEdaIHRGPAQMIPAARFGIRDAMMQAN 624  Methanocaldococcus jannaschii DSM 2661
O27131 567 SAMDNGPVAKEKVMGVKIKLMDAKIHEdaVHRGPAQVLPAIRKGIFGAMMSAE 619  Methanothermobacter thermautotrophicus str. Del...
O28385 564 EAMRAGPIAREPCMGIKVKLVDCKLHEdaVHRGPAQVIPAVRSAIFAAILQAK 616  Archaeoglobus fulgidus DSM 4304
O93632 566 EVMKAGPLSKEPCMGVKVKLMDAKLHEdaVHRGPAQVIPASRQAIQAAMLMAD 618  Methanococcoides burtonii DSM 6242
Q8TRC3 566 EVMRAGPLTREPVANVKCVLVDAKLHEdaIHRGPAQIIPAARQAIQAGMLMAE 618  Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap