1M5W


Conserved Protein Domain Family
PdxJ

?
pfam03740: PdxJ 
Click on image for an interactive view with Cn3D
Pyridoxal phosphate biosynthesis protein PdxJ
Members of this family belong to the PdxJ family that catalyzes the condensation of 1-deoxy-d-xylulose-5-phosphate (DXP) and 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one to form pyridoxine 5'-phosphate (PNP). This reaction is involved in de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate.
Statistics
?
Aligned: 404 rows
Threshold Bit Score: 183.722
Threshold Setting Gi: 315418521
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M5W_A             6 LGVNIDHIATLRNARGTA-YPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTrMNLEMAVTEEMLAIAV 84  Escherichia...
jgi:Cpin_2038      4 LSVNINKFATLRNARGGN-MPDILKVAQDCERFGADGITVHPRPDERHIRYQDVIDLKPLVTTeFNIEGYPSKEFMDLVL 82  Chitinophag...
ASGPB:SGRA_2839    6 LSVNLNKVALIRNARGAN-FPNLLQVALDCEKFGAEGITVHPRPDQRHIRYDDIPELRGKIATeFNIEGNPTPEFMDLLR 84  Saprospira ...
jgi:Halhy_4556     6 LSVNINKIALIRNSRGAN-LPDLTQIARDCEAFGAQGITVHPRPDERHVRFDDLPLLQATVRTeFNIEGNPDPRFLREVM 84  Haliscomeno...
jgi:Ftrac_1784     4 LSVNINKIATLRNARGGE-NPNVVNVAKDCERFGAQGITIHPRPDERHITTKDVYDLAPIVTTeFNIEGYPDERFLELVK 82  Marivirga t...
jgi:Fluta_0118     4 LSVNINKIATIRNARGGN-TPNVVQVAIDCERFGAAGITVHPRPDERHITGKDVMDLSKVVTTeFNIEGYPDERFMQMIE 82  Fluviicola ...
jgi:Oweho_2770     4 LSVNINKIATLRNARGGD-VPNLVQVATDCESFGAQGITIHPRPDERHIRYNDVYDLKKIVTTeYNIEGYPSEDFIKLVL 82  Owenweeksia...
QianUST:TMO_1593  28 LGLRLNHAALLRQAGDGQ-RPDMARLAEATVKAGADSVVLRVDDGSGLITADDVRRIAERARVpLTLEMRPDPARVAWVT 106 Tistrella m...
INMI:Cabys_2707    4 LAVDIDPIAFVRNSF-NDkYPDPIQAVVLAELGGAESIVAYLHDNQKTVKETDIVLLKHIVKTyLNIRCNLTEENVRKLL 82  Caldithrix ...
CDE09685           4 LSVNVNKVATLRNARGEG-IPDVQKFATDCEALGAQGITVHPRPDERHITRRDVALLKPIITTeFNIEGYPSEEYLQLVL 82  Prevotella ...
1M5W_A            85 ETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAK- 163 Escherichia...
jgi:Cpin_2038     83 SVKPHQATLVPDPPDAITSNTGWDTIQHQSFLREVIGTLKAAGIRVSIFLNAETDKVEAAKTAGADRIELYTGPYAEEFe 162 Chitinophag...
ASGPB:SGRA_2839   85 KYPSDQVTLVPDAAQALTSDSGWDTLAFASFLQEVTEELKSLGARVSIFVDPDPKMIEGAKKLGADRVELYTGPYAHEYk 164 Saprospira ...
jgi:Halhy_4556    85 QVKPHQATLVPDGPQALTSDQGWDTAKHHDFLVDVVAQLQSVGTRVSIFVDAEERFVEGAKRVGADRIEFYTGHYAKVFp 164 Haliscomeno...
jgi:Ftrac_1784    83 NNNPAQATLVPDPPGVLTSNAGWDTVKHQDFLKDVISQLKNMGVRTSIFTGTDLKHIEAAAKLGTDRIELYTEPYAANYa 162 Marivirga t...
jgi:Fluta_0118    83 AIRPAQATLVPDPPHVLTSNAGWDTKENSAVLQDIIRRLKSWGVRTSIFVDTDLQNIEYALETGTDRIELYTGPYADNFs 162 Fluviicola ...
jgi:Oweho_2770    83 DNKPTQVTLVPDGPDVLTSNAGWDTIAHAEMLKDVIATFKENDIRVSLFIECNEDYIQGAADLGADRIELYTEDYANGYs 162 Owenweeksia...
QianUST:TMO_1593 107 SLSPAAVMLLPES------------EADVARMAEVASGLHEAGVPVLALVAPEMEAIDQVHASGIRGIELDTTFYGEAA- 173 Tistrella m...
INMI:Cabys_2707   83 RIKPDMVTFVAPGELHDIAPHPLNVDMYPTQLQDFIIELRTNGILSSVLIEPQVEQVKLAGKLEFDYVELDATGLANAE- 161 Caldithrix ...
CDE09685          83 ANKPTQATLVPDAADVLTTNEGWDVECHAEFLRGVVKRLKDDGIRVSIFVAADPRQIRAAAAVGADRVELYTKPYADAYd 162 Prevotella ...
1M5W_A           164 --TD-AEQ-AQELARIAKAATFAASLGLKVNAGHGLTYHNVKA-IAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLM 238 Escherichia...
jgi:Cpin_2038    163 raRTqPQN-LQLFNAYKDTARAATATGLELNAGHDLNLDNLRFfKLHIPQLKEVSIGHALVCDALYYGLENTIQLYKRQl 241 Chitinophag...
ASGPB:SGRA_2839  165 -----ADR-AAAIAPYIKAAEAAAAVGIELNAGHDLNLVNLAYfKQNIPNLLEVSIGHALTVDALYMGFQNVIPLYKNCl 238 Saprospira ...
jgi:Halhy_4556   165 -----SNP-IEAVKKHVHCAKLAVELGLGINAGHDLNLKNLSFyKDQVQGLMEVSIGHALVCDALYYGLQNTIQMYLRql 238 Haliscomeno...
jgi:Ftrac_1784   163 -----KDR-EKAVEPFVLAAKKAQEVGLGINAGHDLSLENLKFlKEKIPFLDEVSIGHALICDALYFGLENTIQLYLRel 236 Marivirga t...
jgi:Fluta_0118   163 -----INK-EQAIEPFIIASKRAIELGLGLNAGHDLNQDNLRYfKQNIPELAEVSIGHALISDALYLGLENTIQRYNYLL 236 Fluviicola ...
jgi:Oweho_2770   163 -----RDP-ENAVAPYTYAAEIANSLGLGVNAGHDLSLENLEYfAANVPGLLEVSIGHALISDALYFGLENTIQQYRRKl 236 Owenweeksia...
QianUST:TMO_1593 174 -----EEVrAPLLQQIRHAASHAHGIGLGLQAGHALDYSTLAP-IAGLPHIQGITCGRFLITEALFIGIEEAVRHTRRLI 247 Tistrella m...
INMI:Cabys_2707  162 --DMdSE--IALLQELDNLSLAANKLGMGVNISGGIGYDNIRD-ITKMENIEDIIVGKPLFSKSLAIGFEQAVRDLIALM 236 Caldithrix ...
CDE09685         163 -----TDR-DAAVAPFIVASQTAADCGLGVNAGHDLNSHNLRFfAESMPKLDEVSIGHAIISEALYDGIATVIKRYRDCl 236 Prevotella ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap